IMD 1.17: 2/05/2009 21:30:57 Cromemco Cromix CRO-PLUS-XCL 151 release 7 serial 10004 disk2 092 FLDSDDST  CLDSDD. 7463 0 0  0 6435256413 4112 1./bin 7463 77777 77777  0 4016376752 5172 1./bin/access.bin 7442 77777 77777  2567 4007575560 7300 02 8ANVH0NH&n EBXJf`/ Hn/N Jg/HyHxN |`fXJg`/ Hn/NL .JgB//HxNt|`2J g,/.Hx/N .JgB//HxN@|` `HyHxNPOpL N^NuNVH0$n&n,. B` F BBRpnHj FHh / N &@ Jg Jfr `0B`$ Hr FHp/ N" &@ fp` RpnpL N^NuNVH0..&n$n +f GBR` Gp B`t A\Dg Z_DJgHHм `HHg:g*Ygg[f$g`````p`Rg .fgR G  L N^NuNVH0&n$K -f R n B` n p +fR n-H a\Dg z_DJgHH `HHrSWDHH n Jg R` L N^NuNVH0&n$n,. B/ F/Hx/ N.Jg `JB/+ F/(Hx/ Nd.Jg `&B/+ F/(Hx/ N@.Jg `pL N^NuNVN^NuHop0//NP6N@FNuNVH0$nG'n'J'n 'n 'n/ Hx"N POL N^NuH $oL /N@QHUHHLNu /"/N@UHHNu "_" _N@UHH//N"/ / o "oN@UHHNu DBad access list: "%s" Usage: Access access_string file_list @(#)access.c 1.2 (12/22/86)1Q68010 XPU 151 Access source 1.2 Copyright (c) 1986 Cromemco, Inc. i*::(! *@ "" >2*N#F#x^#V#G R[*"[*"ͨ*/~(C"\&0 7&*/#"-!H"%b*/~ :Gp! "%*-"/#"/Multiple start addresses $MEMRY.bin c 1:   7 0 wx2 |2ow, z$$<2<2!"x~xw9O#9G+{@#z@+:g.~2}, [ R#*R0"+:W\̟g|2:= :2g:2::g.:+6}:g.::gow, r*ut:!s#r#!4>w>M ~2::ɗM K CFy@w*utC>2ɗM*#" !N#G! !!> Multiple library search requests: !N [-!N"-!("%*/4!͒F!F*-N G *1"1*"*"*[""*[""*[1R0S!:$6!pͨ:w8)z %*8"" !ͨw8z "X >"ͨ8#"22ͨ8#"wz7ͨ͠x2:W! (0!7~!اG#RCS* *}:(=G R*+Z~(~w#z +|W]xDM*g[K*}| ==2ͯyg.W:8Z:(G*]}:(=WO*]T B+}<͠ @[ RM<[ GyH9GyO9!:o 4g  O" X0`A  * ͠ @" *A ! @#* %<> T]*X *8T]8 .$("!" :(!"* *%" $*|(+" !"[ [z("[ :(!G!^#V#^Vut " [R!8* **[0&0!*R!" :2 0CNVhH0N(EpfHyHnpNPO` pf n /(HnpN|PO``HyHnpNPOBB/ Ap,/N.Jg`THnHx/N, /.NTXO&@Jf`FHn/./ /N.Jg`/N./ NPO.B//HxN8 `&HyHxN POp`Hy,HxNPOpL N^NuNVhN^NuHop0//NP6N@FNuNVH0&n$K` .f&JRf$n ` Jf`TRRHH-@ A\Dg Z_DJgHHм `HH".ggR`/. / NPOL N^NuNVH0&n$n JR./bin/blink.bin 7442 77777 77777 12065 3721476403 7146 0g.:G*Rz\:WR** **!::W :G*[ZͧW[*!:W :G %d multiply defined symbol(s) %d unknown symbol(s) Program Data Free memory %04x %04x %04x Start address = %04x :G!^#V#:nf!w !P:W :G!P %04x *|*)*3F s#r# 8++[3-!:W:G!R*|*)*3V(s#r# 8C++[3-!4:W:G!4>2x2ͨ\&0 7&*/6#"-2!H"%bG(!("%*-"/!͒~OG*)B")^Vutsr N 6662nf|(+ 8 : N( N(<:F#~O! T]0K*<(K*!^#V#nf 288 2"4! wG#w[z "!5!+  ! 5/usr/lib/5#~(. T]#~( .(/ !  ! ~# ~#A[ ɧ!FK# W :G!4" !O Warning: Program and data segments overlap Warning: Program > 64K ͎ 8Ͷ  ( !:(*["*"1w#w22go""<2*@#" : *R#:(͗ @2* "*1[s#r#[s#r#"1w#w![- */5*-N  "-! "%: h **[*[:w !!~ :W :G!!~  %04x %04x (%s) !͒F~nf2*@ |GR: `i*:#:(͗ >͠ @/  L gR` L N^NuNVB/.HnBNJJgp` .N^NuNVH0$n G'n'n'n / Hx NPO.Jg `$pL N^NuNV-nHnHx NTPON^NuNVH0$n G'n'J'n / HxN$PO. n L N^NuNVH0G$n'n'n 'J/ Hx!NPO.Jg `P . SkF n>H0;N$$$$$$$$$*6666**$$ ` + ሀ$pL N^NuNVH0$n G'n'R'n 'n/ HxPNNPO.Jg `$pL N^NuNVH0&nE%K%n / HxVNPOL N^NuH $oL /N@QE("WLinker version 00.17 Copyright (c) 1986 Cromemco, Inc. *%")!T]6,!"͂ h8"*[[FF*Bnf|~-#~n(-q(r(x((c(7!"" " !"!"!"!"!~##"B*B##"+*3"/!("%!"'ͨ(!~-(\&8bG(ͷ0*|!( ~wɗ22go"",,"18 (!:(:O!*+^#V#z"+#~G!~( # y=*'!:*%~#fo>M nf[Rs^#V#!z  Unknown symbols: Multiply defined symbols: *)*3s#r# 8++[3̀!-:G> >2^#V#ͱ x :G:G!F( nf! ---- %04x^#+> !5 6> :> [R~OG "S*##"bk##8"*++(0"[*8ͱͱR[*RѧR0**++####**##*[*++--Fp#FpN#F#^#V#:G(%^VnfR 6C#og  x2C*| !"!:G8bk+"*!~#"!OC#!Ɨ:G DM!T] ͯ8%%%%%o70:8 ag?'0Ʌo$#Record type %d: not yet implemented Unknown option .rel.mapbdipsz1J%70>w70iw!"H! "L[3*/S/"* Z 8 ! "%! "'*B##"+*[*)R8O:G 8Eͨ($~-("\&8h G(ͷ0!~( g 0b { ]./bin/boot.bin 7400 77777 77777 2646 4007575644 6775 0 HUHHLNu /"/N@UHHNu"_" _N@UHH//N"/ / o "oN@UHHNu  J/cromix.sys.sysInsufficient memory Usage: boot [] @(#)boot.c 1.4 (12/22/86)#E1Q68010 XPU 151 Boot source 1.4 Copyright (c) 1986 Cromemco, Inc. / Hy" /90N $ Hy"Hy10NHPO$@JgHy"$/ N4PO$@Hy"&/9 Hy"*/ NPO/NPO/NPO/90NXOJg Hy!NHx HxBN/ HxBHxBN/ Hx"BHxBN/ HxHx `HHHHgg . ` /Hy%/.N>PO/N6PO .L N^NuNVN^NuNVH0| n $p" g JR -fgR -f`J*WDHH* JRHH.JgtpA_Dg rZ\DJg м ` .&n`Jf`J\HHfJg`6J+fp'@`Jg n R'pJf` `~`< `pL N^NuNVH0$n &n` Jfp`RRgHHHHL N^NuNVH0&n$n JRgR` L N^NuNVH0$n G'n'n'n / HxN:PO.Jg `$pL N^NuNVH0$n G'n'n'n / NH`HnHx(Hx HxBN ^HnHxBHxBN FHnHx"BHxBN ./.NnXOHnHx"/.HxBN HnHx/.HxBN HnHx(/.HxBN /.N nXOpL N^NuNVH0&nBB >f~R :fzR  g  g  g  fR`$Kg.  WDf  WDf  WDf  WDJfR`BJf$J g /90N XOB p# `ZBJgp` </Hn/ N ,JgB/ /HxN` #0p# JWDHH# pL N^NuNVH0&n  g  g  g  fR`$KJg  g  L /N@QHUHHLNu /"/N@UHHNu"_" _N@UHH//N"/ / o "oN@UHHNu@@H@  @@" @$  @@  Y./bin/ccall.bin 7442 77777 77777 17755 4007575766 7152 0NjPO/NXOJ g@ g6 g0 g* g$ g gHH/HxN"PO/NXOL N^NuNVHGB/ /.NZPO,JgBB/HxN p`" fp`  f~Jg  gpLN^NuNVH0EGBB0 HnHxHxN HnHxHxN HnHxHxN HnA/HxN HxAHx@/ /.N(.JgBB/HxN `4HnHn/ BN.Jgp.f`BB/HxNHn/.HxN Hn/.HxN Hn/.HxN Hn/.HxN J0 g/ N.HxNPOpL N^NuNVp#0 r N^NuHx/N/ HxBHx/N/ Hx"BHx/N/ HxHxHx/NL N^NuNVJ fHy$Hy HxN HnBBHx/.NpN^NuNV/.N &XO`N^NuNVH0GE/ HxBNz pg/ BN ^PO/N RXOJ g ~fHnHx>/90HxBNrHnHx/90 HxBNVHnHx"/90HxBN:/ HxBHxBN$HH/HxNPOHnHxHy0$BNJgB .A0$B0Hy0$N.Hx"/.HxBN/ Hx/.HxBN/ Hx>/.HxBNp# `V Hx NPO.Jg `$pL N^NuNV-nHnHx NPON^NuNVH0G$n'n'n / HxNPO.Jg `$ pL N^NuNVH0$nG'n'n 'n 'n/ HxNHPO.Jg `$ pL N^NuNVH0&n E%n/ HxNPO.Jg `pL N^NuNVH0$n G'n'J'n / HxNPO. n L N^NuNVH0G$n'n'n 'J/ Hx!NPO.Jg `P . SkF n>H0;N$$$$$$$$$*6666**$$ ` + ሀ$pL N^NuNVH&nHnHx:N PO.Jg `&gR`Bg#!Hy!NXO.`Hy!HxNPOHy!|NXO.pL N^NuNVH0&nB  g  g  g  fR`/ Hy!NLPO$@Jg&J~  g  g  g  fR`$Kg.  WDf  WDf  WDf  WDJfR`BJg A! `A! /Hy!/90N . / Hy!/9 Hy!Hy0NDPO/NN^NuNVH0&n $nJg/ / /.HxNN L N^NuNV/90NXOHxNZXON^NuNVH0..GE/ Hx"/90Hx/N/ Hx/90Hx/N/ Hx/90Hx/N/ Hx"/90HxBN/ Hx/90 HxBN/ Hx>/90HxBNL N^NuNVH&n / /.NPO.Jg p.g`` LN^NuNV/.HH//.NPO.Jg p.g`` .N^NuNVN^NuHop0//NP6N@FNuNVH0&n E%`RRg4 A\Dg Z_DJgHHм WDf  WDf WDf WDf WDHH# HH//90N $PO/N XO`f/ An/HxN L N^NuNVH0G ` /./N@PO$@Jg / kNXO` PA!> nHy!>HxNxPOpL N^NuNVH0$n&n `< A\Dg Z_DJgHHм `HHHHgp` RRf L N^NuNV/ &n/ Hy!f/90N p&_N^NuNVHy!jHxNPO/90N BNjXON^NuNVH0&n  g  g  g  fR`$Kg.  WDf  WDf  WDf  WDJfR`BgBBHn/ N .JgB/ /HxpLN^NuNVH0G..$n Joplp"`p'GA f SA%D"0` "'A/ Hx@NPO,Jg `2 n-H SA%D"+fC> ` + n pL N^NuNV/ G'n'n / HxAN2PO&_N^NuNVH0G$n 'n / HxBN PO.$ L N^NuNVH0$n G'n'R / HxENPO.Jg `$ n  n pL N^NuNVH0$nG'J'n'n/ HxHN|PO.Jg ` n pL N^NuNVN^NuBH />A/NTXLDXNuaaaaaaaaNV-nHnHxFNPON^NuH $o 10-fsfile -q %s rfile -qwf . -d ###"#D###$$,$Z$~%s Ccall aborted by a signal @(#)ccall.c 1.5 (10/17/86)110150300120024004800960019200.~<>shputtakehshellshell-cshell-cshell-c~. Terminate Ccall~~... Send line "~..."~< filename Send contents of filename to remote system~> filename Divert all characters to filename~sh Interactive local shell~sh command Execute local command_! Out of memory !F[2S} >22~(Y#!8;(/ ~(H#!0;0~+: ~͗ A##:2G:2( )x22~(!8; k ͗ k #k k 7a{_2 :2<ͅ *2" " 8/F [} (͈8 V(: ͇Ϳ8N( ͏ b 8 !K *2" # !w :w ݾ 8 w :x w :y ݆ w *z ^Vut:| ݶw[ * R( # #  7  : 2x : 2w 2y : 2| !: W ;>2y 2 2( G: 8.(,  :2o!| :2G:( : 2x NCdoscopy version 00.15 Copyright (c) 1980, 1981, 1982 Cromemco, Inc. *%"6#s#r*B?nf|(A##ͅ! 8<dY(eY(lY(wY(= ͕+8 !F!!Wrong number of arguments r8vnf|U##+2 K2 88222 2 !_vY(!!VvY !lDeleted Not deleted File not found: "%s" Not deleted: "%s" r8tnf|(##!+2 2 8@! f.<! ~o0$:2OTz(#ST!2 #####( ~(*Η<7*V* ~22:G:07(*Χ:( n0f1:_6#:w#p#q # ~ 8365>ݖN(F)O0 n+f,^->ݖ=o0$0 n(f)>o0$u(t)~% *F7 X}5%*^ &F.N/p.q/!88w+q,p->݆+w+ 4, 4-N(F)n+f,^-~&^#V$s(r)6%*^ EFN"8G*f(xݾ(*pq"4%!= (*y<  n0~#(/(^(*([(?(xS2R"2!p3"} "2~ k # k 22͠ ! "[ * Bs) !2w2 *2"2"2!9%R8|( 0>w& >>!}" ! " !&1~# s#r#= .n-~.n-~#fo͋0!Ë0!91z Ì0p .}x ͓0Ox(_8x[#xGͬ-> C!:!}!s#r#p!###͏-/!!###1/^#V#w{*B18\S*@1S@1S {O_ݦ{/ݦw~%w~&w^# x-XO !͍-͍+͋=(~@7~ wn&))u t #_~/u ~ w .n-#.0n- ͬ-66 @6 6 w w0w1w2.n-6 #n!&NF ͦ0Nv(N/ͦ0B0N 0NF B0N~put file_list Send files to remote system~take file_list Copy files from remote system~h Type out help filer1Q68010 XPU 151 Ccall source 1.5 Copyright (c) 1986 Cromemco, Inc. r/etc/passwd/dev/%4%8%<%@sh-csh-cUnexpected signal number %ld UUUT( ((*I0"z * " [ * R7( !" [2"2!9R8 0 !K w2 2  2SYS DIR:  72!"* ":< 2~(: 2#22 : !7ȧ 2!"* ":< 2~nf| !File not found: "%s" %-15s%6uK rnf|##+2 2 888dx22uw(^28+:2G +~  x2:2G84bY(:ob:2G ͫ:2G 0!EFile not found: "%s" %-25s %8l,d bytes r2nf|2## x222~<(|p3!9%%R.:2G8<B82&|  >G>w#! *:22<("ͫ:2G 55!U!cf1X~($#y0 "#V#^y???<= 8 >O 7ɧ!v(@w#6:#k (6.#k6v (w# ( ~/($# ~(# x !!7Device name too long: "%s" Device must be in /dev: "%s" /dev/~O #nf~- ##!"q*q|( ~#((<"S  "bk 8"*B(0"[ 8R[*RѧR0**B ** *[*Bss........~#( x 7 # x a{0^VR8 ~ R8ut^'V(N)y(A~&o&)))n$f%6#= yͰͬ-R0DMͰͰz x>(x-ͰͶ{=͜ͰSͬ-o&)))))Ͱ ::Gq\8{=( (~͙[7qqJ y*91Oy??!0͕"8 KͶy>>*91O ^HVINJ~KsHrIqJwKwHwIwJ6KsLrMwN^LVM~Nn f w/w>:::{*22G2~ ((,# ~ (>.(~ (( # !2ɗ!2!Z7Pathname too long "%s" 58A 8=583!z ;x22z22z22o( 22 ! ! Not a CDOS diskette Not a block device +w#RA[ *91!9ut .w ~ 112!~X!3 O ^#V!h~ nf (͓0"͓0^#V+++"!ͨ/æIllegal system call H at H *91s#r#s#r#q#p#s#r*91N#F#N#F#N#F#^#Vwutɦ(+F+J+V+^+h++++,w!E&$$2%6"&(%"+#)59h#%'*$$vz/ &m1="0's(([%͓0| !9͓0ͥ*91112*91 ~w F ͞O8s :~  Ì0F  ͓0ͲF ͇ Ͱͬ- ì-͇~ #!0z(! DM0 z 7. n-~ x y(YPͷ͇R(0So&R0ͽx-.n-^#V.n-~#foX!/w^#Ͳ.2  0<&E 18,E~(W((E ! ͨ/: (Bad directory block H ͇^V>w#!8~(E~(?͇ ~(! ~ ^^#V#.n-~#foR8ͷ x-͍- n(C~*+,(4 ~ &(&PY͏(~{/wJ/8 (66.++ 0 !A+ï, {0! //d+!//!%/)//~( {+({>:{2$0^#s#+ͩ++$+++,,,,2,_++ c,h,,W~((####~#fo͋,sè,z+͚,~ ܚ,7͋,ͨ,zB##~͋,#͋,ͨ,##+8z>\ͯ,ͯ,ͯ,+~ͯ,+ z(>/ͯ,ͯ,ͯ,é+ͯ,V(z +6#z(6rG{p#x 0 >^ͯ,@>ͯ,> ͯ,>> ͯ,> v ^0/(>!~4w!|#1æ.. ---/2--!-es, $ K Displayed, $ K Left ***$ $ ~/|)!F!{0_F+> ?!R!U! F+,"+EW@R USͩ" Z(>! 6#!͍-~ V ::w^ #q ~(#p#y( ! 6͋#>8!~I> ~H=w#j/6!+"  # SYS DIR="4@ G~ O ~ <(9w q w!((y!0 ^#͕"0> #>! >"8%.n-Nl&Ϳ0Gͦ0 0{G!x-4. n-n}(O N{(#F+ ( x( x( 7{-!".*>1F#~##( Aͬ- #1I1&1p3p3,"($E&>(~ <(w 6 w! ͏((>>8M! ~>'͆'0 ^#0>(sx(#r͆' #ѷ> ! ~!8>C#>O#>M*91 q#p͓0'͝0 j/6! 6w!?*91 s#r+!*@1}|0)(͝0 ~0# !(ͨ/-program too big'͝06" (s#r:H1(*@1*91H !͓0|)͝0~6*D18̈́(>8^#! ~"ͩ"(S͋^#̓#86~(~ V . n-v ! (&(!~) #*8 )% !>S))N^NuHop0//NP6N@FNuNVH0| n $p" g JR -fgR -f`J*WDHH* JRHH.JgtpA_Dg rZ\DJg м ` .&n`Jf`J\HHfJg`6J+fp'@`Jg n R'pJf` `~`< `pL N^NuNVB/.HnBNJgp` .N^NuNVH0$n G'n'n'n / Hx NPO.Jg `$pL N^NuNV-nHnHx NpPON^NuNV-nHnHx NTPON^NuNV/ G'n'n 'n / HxN(PO&_N^NuNVH0$n G'n'J'n / HxN ͬ- !12ì-~*_~+W~,zq!#8,~O8x<~!( 7 zW{_ͩ!͙^#x-͋~#Ɂ ?(=_*>1~=8 #~#(>7ͩ ~ &-+-A-E-y/y)/y/ ͝0qy2h-y2j-PY Ì02h- ͓0Eì->>*h-s/*j-+ ͓0E ͓0Oì-͍-*>1X#^#V͗-ͤ-^#Vͤ-s#r*91#2.S.".x-͍-y (( 8--3.-8-88 *.:._f  8(;S\e>o:2G8 *.:2G:2!.( !. 5:2FO(p!FW(F_(p6 !.Pqp Hq*p+>w!NFqp ~w~w/((6:M@4Z^PPPPW>W>5/5/5/5/^# Ó0#xGì-K^#̓#~G ,W   ! N ~G ͧKN(ŧ?G*>1~8x( X#~# F 8 #?( ѧ7>  ՗#~+: ~?&@8###.  ##! w! wË0~?&!/=,.(*(#>?~/͋0Ì0s/KKK^#Kv '̓#~G MKF( W( KKKKnK(6J4J(NJ((~G KN(8/ͩ͋"$^#x-K?(K! ~?(#?$>ut[91!pH (![9./bin/cdosfix.bin 7442 77777 77777 3277 4007576071 7473 0ݾ3(+*91'!*91' ??w ="(*(O8* BO*& 5x* /* %~ O*& ͢* ))>*#w! w*q#ww #w^#͋8~ *.n-]i&==~/{s/E! p( & = y*.n-}! n&_T~/{(&(^#q͙ ! 8w##6ͬ&>*~w ?? (&(Ͱ]T6PO. n L N^NuNVH0G$n'n'n 'J/ Hx!NPO.Jg `P . SkF n>H0;N$$$$$$$$$*6666**$$ ` + ሀ$pL N^NuNVH0$n G'n'R'n 'n/ HxPNPO.Jg `$pL N^NuH $oL /N@QHUHHLNu /"/N@UHHNu"_" _N@UHH//N"/ / o "oN@UHHNu@@ HInsufficient memory Usage: Cdosfix filen  >?>?w !"l"n"p͋r81Q͌+c!( !Ì+(1r Press any key to continue $͉>O!͉ !͌+>8^~#^{ 0.F+R!#^{ 0.F+R!8 #!KF+U!!m!^#(F+#U! c!7 <^#̓#82~ *n#"nW(!!~G! ~(x(~XWj&))))))).n-NͿ0z(#ͦ0Ϳ0*l"l*p#"p^#x-͍-!nf^VN8#z(#Nͦ00 ͌+*p'! ͌+*n'! ͌+*l'!!͌+'!!Ì+*** $ Files, $ Entri5/5/5/ 5/"5/$5/05/25/45/@5/B5/D5/P5/RDM !_/ _/[/! 9F+Ni`_^#VxBKͦ0BKͿ0W͐/zS0:__~͆/z0{0*91~(/0###Ĝ/+͜/##0*91.85~(.6 ~w .(.sw~ 7/   6 nb~/>_> g0 g0/F(/%/()/ 4͝0s#r͝0~#fo*91 >C( = z {?>70BB0 = *.}+".}͍-1͗1!Hp (z *$88 ^# ͓08!ͩ͋/$0 x> yz%8ͩ͋#8 ~ z%>6 ^##͝~(&=4<^#O#. n-~^(#V#b $%>ͩ͋!5$F%͋/$F% # ?(w#$%>ͩ͋!H5$F%~ˑG(w$%#a_">͋#>d&!ͬ&^#q ,͙ .!N! ~! 8w!~ 0 q'%ɗ># $#j/^#$% !>͝>0' 8! 4> )2 8TNVH0N&n B/ HyNPO-@Jg ËҀË``Jf`HxNXO$@Jgl`dHxHxHn/N.JgB//HxN|`0/ /.NbPO.JgBB/HxNx|/.NXOXJf`Hy HxN:PO| `Hy HxN$POpL N^NuNVH0&n *.EHnHx/N B`t/ l .` <// /Nr.Jg `L Hs/ NLPO(l& Є/B/N .Jg `/NXO` ܀ JfpL N^NuNVH0$n&J` f` R m L N^NuNV ame [filename ...] @(#)cdosfix.c 1.3 (12/22/86) d1Q68010 XPU 151 Cdosfix source 1.3 Copyright (c) 1986 Cromemco, Inc. VHxNPON *pAn rZm pyg~`zpqfHypHxNPO|`HyvHxNPO|HxHxNPON 2`J`g|JgN `Bp#3(N /91/93NN;BN4NijNMN Hop0//NP6N@FNuNVH0BB-y1p 91xS-@HnN#fXO n"h .1HH-Ag$Sg2gUg,gUf&gB~}`"B~)`B~]`|~{`|~(` |~[``\&nJf~ k .RE k p0+SC-IJgT`* HHfR` HHf JgSbJg Ep x.` E Ю쐆"j xRp0*b/// N ~`$ A1p" f!".ӰSRp l/ NXONHx/93POR38mJL N^NuNVR3p3lB3p#3(Nt/91/93HxNP Npf`Lpg HxNxXONZp-@`J34g / NXO`/ HyVHxN p-@0N2/N&XOJgpf`V/92`/92PN@PO#,JgN2,Jg // NPO`B`XJg // N~PO`BB0`zNJgHy0NXOBJVDfJ0VDHH/NXOHyrHxNXOpfNL N^NuNVH&nB 9g Sg>SflgR Am Zo am$ zn Am Zn ` HH.`2 am zn ``R oR&k$k k p0+SC-I``^ k .SE gL`( HHfR` HHf JgS``*S lR&S g k p0+SE`N `ppf"D&#1p R#1x׹1tBBN!POHnN!XON!HnHnN!POJg/9NN!XO`/91/93fHx:/N!>POHxHxN!6POJ`f/91PHyHxN `/91PHyHxN N!.pAn rZm gggWg SfNgJ3 gTHxHxNPON NJHy:HxNPOHy3@.o Jg `p#1"93@ҹ1'ANxHxNXOL N^NuNVH0E1pB&RB`p1fR/ NXOJf"/ NXOJf . " g&kR`/ NtXOJg . " g&kR``L/ NPXOJf / NDXOJf ." g&SS`/ N$XOJg ." g&SS`R38mN$ߪp0+"91ҹ3@c>0+gp0+`p,p0+%@p0+3@#1r1o#1 й3<,pn"0n#3p`(p0+Ю-@B` E"k xxRp0+ HxNnPOHnNXOJg`HnlHnNPO.JnTHxHxNPONN8JfHnHyHxN `HnHyHxN HxNbXO`:HyHnNTPOJg`"Hn`Hnd/ HnxHn|N:Jf NRp`Jf` ѹ1h .dѹ3HxHxNPON/.d/HyHxNtHxN./91p/.x/.|N#|1p n|p0(3@dB3@/9NNnXO 93@R#1xr#1/91/93/90/.N Jo// Hx/.N2L N^NuNVH0,. *.E0 ЮS&@ ".o ` .R. ЇoHxN PO ":HA:HABAЁ"$:HB:HBBB҂$2"ԁԀHr(HybHxN , `:Hx ":HA:HABAЁHr/HxN A2"0_//HxN V/N BHx(HxN PON ~HyfHxN POpgVN ,p0nr9m$R(/N nXO`0pfJgSr 8N`N*`pgr f`N`Hx ":HA:HABAЁHr/HxNR A2"0_//HxN< V/NDp fB68NHx(HxN 8PONHnNXO. WgSgBSg^Sg_fg#1\p1\n 1\op#1\.91\`#2p2o# paf,9//93HN&v` pfg rFgtsf##3HBB mfgk znH0;N"D~"<vnDnv^.Pf PZlz:HPb|H0PZlz:HVp`p#Jg #13D/N6XO`BN0XO`HxN"XO`N`BNXO`HxN XO`rN`jN`bN`ZN`RN`JN`B-AHyHxNPOTNx./NXO-@Jl`BNXO(Jl`HnHnHn//.NJf`pf"BNXO,Jl`BNXO*Jl``,.*pfB` A1p"0S,pf*<` A1p"0S*nN`JpgRHnHnHn/./././///./.BBN4` /93POJf(N/ HyHxN HxNXOp`Hy/ NPOJf0Jg,J`g$B`NHyHxNPOHxNXOBBHyCT/ NJ1 Rr2(Rd2N $HxHxNPONZHyHxNPOHxN XO`BHxHxNxPON*JgHy HxNPO`HyHxNPOHyHxNPO~` J g/Hy HxN Rp lJfHy&HxNPOHy*HxNPON ,pf`zp1_Dg r9\DJfJgz`p*gzJgN ,`4 0.Jg A"J `$p*f~` B Rp l` B N J/91/93//.N& SJo// //.NL N^NuNVnHxHn/. /.NN^NuNV/ HxHn .U//91pN\&@ .T-@#3J>lB> 92й>JmB>.9>`po~0o.90#NB` ":HA:HABAЁ"Ҁp Rp n ":HA:HABAЁHr/NPO ":HA:HABAЁ"Ҁp "$:HB:HBBB҂B2!/HxN~"A2/0/HxNl"V/NPO ":HA:HABAЁ"$:HB:HBBB҂$2"ԁԀHr(HyxHxN `NHx'HxN(PON`6B`NHx T/N PONJg/. T/N\PO n-h`JgJ3@f Hx~NdXOR .N`:p1f BNXO`BNXO`HxNXO~` BNXO~`HyNXO~`pf /NXO~`N`pf BNXO`N`HxNXO~`BHxHxNt ~`Nl`Nj~`v/ NdXO-@~`d/NXXO~`VNR`NHxNLXO~`>BN>XO~`0HxN4XO~` BN&XO~`HxNXO`BNXO`N~`N~`BNXO`HxNXO`N~`N`pfHxHxNPO`N`/ NXO~`N~`~N`x/NXO~`lHxNXO~`^BNXO~`RHxNXO~`DBNNPXO`pf2HyHxN\PORN SJgJ1fNJ`B`p f2HyHxN$PORN SJgJ1fN`B`p?f BNXO`p/f|BHx/ "93HxN XRRpnRmHx .V/N PON 2Hx/ 93 HnHx/ N, Jfp`D Ծfp`6 .మf"®ؾfr ` .f"®ܾfr `pL N^NuNVNHxNXON^NuNVH0&n $nBHnHx/ N .Jgpf&r `p`Jg p&r `pL N^NuNVH0E&nBJ,fp`nBBHyGn/ N*JgN/ HyHxN NBHnBBHxBN4HnHxHyGv/9GnNJg~`/ HyfnS`R m j Ch *p1f // NPO` D// NPOL N^NuNV/ &nN`p1f/. / N"PO` /. / N PO&_N^NuNV/ &np1f/. / NPO` /. / NPO&_N^NuNVH0G1pBBBBvJ`fN8`BM.BM*$SJfp#38pfJ3@g fxB`dBNlXO-@Jf N*p`j/ /.NPO$n&p#1"91ҹ3@'A/91/93p`~~` BRp lJ,gB` BRp l/ N XOJg,+~`4 " f&n"$3R-` r-RRp lJ,gH~`> " f0n"$3R-` r-RRpl#3@Lj-y3p#3N /91/93HxN#~POp-@N#x-@/.N#rXO-@Jl`BN#^XO-@ Jl`` p-@-n,91p 91xS&HnHnHn/. /.N Jf` .A1p-p". -p2`WDH/N^XO. *S, 9LHRLH @pHfN"JxfHJLg@p f.JLzg RLvBLz 9LvALRRL~` BLBM. 0mTNHx/93 93$g"`p?"M2HxHyM2//93+g `p3/+ NXOLN^NuNV/ &n3/ NzXO&_N^NuNVH0$n &n/ NXO'J 7np#3 L N^NuNVH0 . f`2&n$k/ N8XO&J g$k` f g/ NXOL N^NuNVH..n~/NXO`fN`HxHxNPONHyHxNPOHxN8XON.pAn rZm prfxHyHxNpPONp./NnXO,Jl`fBN^XO*Jl`VHn/ / //N4Jf`/938HyHxN p#M4N.pAn rZm pefr#M4BHyHxNHPO`prfBHyHxN*POBHyHxNPO|`& J g/HyHxN p-@Rp lHyHxN&@Jg ߹3 `pLN^NuNVH0..Epor` X"¼Ё".JgJ&R&k* n4 Pn Г&@&` R!k fBA `D$&kf м,/NXO&@Jfp`& X/NXO`zL N^NuNVH0$n Y$@ f < g/ BNPO` <$Jg y&h o#` l o #&k` y!J%K&y Гf k ѓ k'h`&k Гf k ѓ k'h`# y (o y#` y&h` Гm / HxN&PO&kHxN Hy"HxNPO&_N^NuNVH0EM@GBBBBJ`fNx`>Jf6HxHxNfPONfN/938Hy 8HxN p#MN8.pAn rZm pegrqgtvg prg` gg(SgTYfg2p#MBB/B/ /N6&@ f N Zp`Bp0+/ np0(//./ /.N&@ f N "p`B( n$hB g^p0*-@/.N (XO(Jf Np`B` D"h . j R .m// NPO$jR`JfdBNXO(Jf Np`NBB/.B//.NB(B Dp0(/ Fp0(////N(// NLPOR*91p$KJgR`$j E*(/ /NTPO//// N.#1pJ3g(Jf Hx3@R#1xr#Lz$93@Ljg6#Lj3@J3f"NHx/NPON//NPON` J3fNR 9L~R#1"0o:&0J3fN/91HxNPONfN`Hx N.XONpNJ3fHx/NvPONJ1lg& yLLJhg/90/NPPOHx+NXO`6B. yLLp0(/ R/ yLL/( й1//NJ/91/NPO L N^NuNVN^NuNN NآNȨNкNN-N NNh0N0NNNlN NȊN֤N"N\NNNNNiNi8NN- NhPOJg0HyHxNPOBNXO#M8Jl`p#`N@//9M4HndN6 #M4.dgHndHyBNPO` NNHyBHyHxNL EBJM4f`BEBgRR`EB-S$-k-kJg 9M8*3`p1f*+`*+A"K 9M4Sg SgSf$gA|#`Av#` Ap#Ƹ38lnJ1ff//91HnHnHn$// yNJg>R&$/91/.N$ Ы'@'n T/BNPOHn(NXO`NHn(HnDNPOJg/9NNjXO`/91/93mBMdB` JR"nxR m ѹ1t#1x n"h .SA-H4 T/BN|POHxHxNPO/938Hy HxN Jf JMDgHnNXOHnHnN8POJg/9NNXO`/91/93BN2XO*Jl`,HnHnHn//.NJf` HxHxNPON/Hy!HxN JfHy!HxNPO`(pfHy!HxNPO`/Hy!HxN Hy!HxNPOJgHy!Hx"n-H i "nhRR np0(b/./.8/.N& p-@JfJMDg&/91/93B` n"h R-I"h nhhRn-E,`& n"h . D-I"h nhRR Dp0(b/./N dPO/N XO n$g D((`-DBԸg$-R n$ R/N 4.N XOR` .谮moJ3g&/.N XO'@ R'@ +3@#1/.//.//./././.N JfN /91/93Hx/ "903Rf6 R$ MPfp`\ R# M\&h R"h Rp0(A.`, o  gR` n f R$ R# M\`#M\ L N^NuNVH0$yM`AMx йJS( Ю l & S"@  fSJf8/N BXO*Jf N NNNlNN.&NNN+NNVH0$n BNXO&@JfNp`4 k p~B R& RJg R"P#K R n"PJf n"P"L N^NuNVH0$nB/. NXO./ NzXO, Іrl./. /.N,PO&n KRgoR`S/ / N POL N^NuNVH0&n$n KR"JRg`L N^NuNVN^NuNNh0NhnNVH0B&y1p .38lJ1f" 2Pfr.N^NuNV/ &nHy"/ HyQN N&_N^NuNVtH0Jf`|EQpgrf / NXO`N/ HnxNPOGx KRg`UplGxHnt/ NzPOJo/ NbXO/ / NjPO/ NPXO/9R N\XOL N^NuNVHxN`XONN^NuNVH&nBBHy1/ N.JgB/ /HxN&NB#1"LN^NuNVHn/.NPON^NuNVNN^NuNVHz| J1TgNB`BN<.rgRplB/N*.N*XON*NNHy"HxNPO//HnHy"N JfHnHnHnBNJg`NNpgSJl~0,r n| k $93@Թ1U0(HH//90/93N:o0J1f( 2PfN`R&S/ N2XONR3<`N`NLN^NuNVHG1pWDHH.Np&#"B""ҹ3@#1x1fN`JgNp#"NLN^NuNVH0E1\G38B`F 91xS//NX .*p1f &BNXO`fB &BNXO&RlJ1gL N^NuNVH0$nB&JpfJg R1xfN `d 91xS*|p0+c Ы $@JgBB&+  g gl  g gRS`궊l  g fRS`,`8Jg4 S @ f( S/HxN V R, JR gS`1xR1p1oTJf&SS1tS3<#01`0J3@gXp 3@o"93@`p ".J:l#3@:#3,#3<303@߹1/ /93SR&SS3/N Jf N p`B#N"`jpf`f QgUg.Sg$SgSg(f&BNXO`:BNXO`0N`*N`$N`// /N4 JfNp`N` #R03NNL N^NuNVH0..&.&n EpR//91/./NJgHxHxNHPO`/91/93p0+d// NPO&@Jfp`dB` R//+ Hx N Rn`.pfr##//+ /N0 pfB#`//+ /N pL N^NuNVH0&n ER4J#fND`RpHfN6p#3 ". J3$g `p?Hx/ /91/93POR$j0n 2`fHxHxNPONR1 910o S1S1x#3@L N^NuNVH0G#(93@R й0 nJfN `8NHxHxNPO й0S,HxHn 93PON^NuNV09#2H//9#4N PON^NuNV09#H//9#NPON^NuNV09#JH//9#LNPON^NuNV09#>H//9#@NPON^NuNV09#zH//9#|NPON^NuNV09#H//9#NPON^NuNV09#H//9#NlPON^NuNV09#H//9#NNPON^NuNV09#H//9#N0PON^NuNV09#H//9#NPON^NuNV/ G#J1f:JPg0+NH//+PNPO`Jhg0+fH//+hNPOp#1&_N^NuNV/ G#p1f8J\g2+ZH//+\NPO`Jhg0+fH//+hNrPOB1&_N^NuNV/ &nN^NuNVpVo"9VRVAV N^NuNVN^NuN NNNN- NNNFN NjNNiN NHNN+N$NNVN.NNV/ &n&3<'y1&_N^NuNVH..GJHgNpAnrZl pan`p ".ARR$j0n 2`f .A/HnNrPO`JgP~`8HxpJf ":HA:HABAЁA! RJf L N^NuNVH0GEg,B/ / N Jg/ Hy&HxN N`FB/ Hy&N Jg0B/ Hy&N JgB/ Hy&N Jgp` L N^NuNVH0G#J(f(HxNXO#(JfHy&HxN~PON~BBHnHyVNZ,JgHyVHy'HxNH NFHx/9(B/.N8,JgHy'4HxNPON/.NXO-|AR($K`t0*S@g S@gS@f>g$//9(NPO.`*//9(NPO.`/.///9(N.Jm R5@0*Hrf %D؇,.p0+dp0+, R&B` k ЄSCpHRn//NPO/HnpN PO&kR oL N^NuNVH0.. ,.EG#JXgxJkg< Ю//N8PO0+bH//+dNPO//NPO0+VH//+XNPO`6//NPO0+VH//+XNPO/./.NPO0+bH//+dNPOL N^NuNV/ G#JXg&Jkg /. /.NPO0+VH//+XN PO&_N^NuNVH0$nG#JXgN/. /.NjPOJkg.Jpg0+nH//+pNPO`0+bH//+dNPO` /./ NPOL N^NuNV/ G#JXg&Jkg /. /.NPO0+bH//+dNtPO&_N^NuNV/ G#JXNHxHxNPONJ/ HxN.PO/91/93N XO0+H//+N PO$j0+JH//+LN POR0o$nJg0+H*//+HnN V R&x*.G1p CJg C&(g~`R J gF" f>"3S,Jl n mB `l "`n "ӳRp lJ,g\~`R J gF" f>"3S,Jl n mB `l "`n "ӳRpl$j`4L N^NuNVH0*. 91xS,o p1f N ,p` .A1p&p". -pl* 91-@NB(.`0Jg /Hx2NJfHx`pozplz#NHy& ":HA:HABA0*c A' `A' //90/NR$j0n 2`f`h/90HxN~PO~`Bp0*cp>`p /NXO0+H//+NPO0+JH//+LNPOR$j0n 2`fHxHxNPONS1p1o R1R1x#3@L N^NuNVH0*.E#S /. S/. *g *` */HnN0.J3$g6//.AHpxN AGxB` fp RRn`6AGxB`& .R @  lp?` fp RRnޅJg$0*H//*AHpxN 0*Hހ/HnNPOL N^NuNVpH0(.&nE#JXf` JfBB`z A%*0"$҂43UBgSBfTg* "ЁJsf/3Hy'XHxN* |`( "ЁJf/3Hy'hHxN |RpnJgHy'xHxNPOHxNXO0+&HJWDgJWDgJkzVDHH#02+2H#0JtVDHH#1`JVDHH#3$JWDgJVDg JDVDg J8VDg J1`WDHH#1lJVDgJDVDgJVDgJ8VDJWDHH#3#X1XJ3gJ1lgB3Jg/+Hy'HxN /9(NXOL N^NuNVS /. S/./9#HnNd/HnN\g:/. /.NPOJpg0+nH//+pN6PO`0+bH//+dN"PO&_N^NuNVHG#~Jg0+H//+NPONʐ0. LN^NuNV/./9$HnN /HnNPON^NuNV/./9$HnN /HnNPON^NuNVJy$g Hx NVXON^NuNVH0GVN*Jl ` RAVE'`vHH"ЁA#C, "F0)Hl`LB`"AV"F-H i"n1x0xg`Rmھl` F0(Ho`tB*HH`4TA' n~JgS AV0HH/NDXO`N L N^NuNVJVfNV`SV 9VAV0HH   Jgv .0nj"91//.N8PO .ܐ3@"90SoB`NRn`,Np0+/ .й3@//+ /./.NR&kR g J1g›1x1Hx/ / n/ .A1p/0N&pL N^NuNVH0 91xS-@"910f NDp` .A1p&p". -p-nJ1`gNNB . g`p ,` .మmv*91(.p0+".RcJJ f JgR`PJ$g/./ NPO&@Jfp``p0+(p0+3@R*p0+Ю-@/.NXO$@Jfp`BB` k xxRnB` ЇR|Hy*HxNPO`< 0, A1pJ gHy*HxNPO`p nN\N` LN^NuNVH0$nB&JBB`bNt.pfx`Zp fB`Ppg rgfJg SSN`N`"p nrzlN`/NjXO KRRR m L N^NuNVpN^NuNVfH0Ej` Am Zn RR nfB n&Ppf" fr ` k "n E k p0+ C* mV Am Zn .jf:( Aj,` D Am Zn Fg` RR Ff FJf`R`0&kR g fp`$k k p0+ C* `t k "n UE k 1pp#3 / NXO, E!K E Jg S!E`%E&R~` J g nRRp lJ,g ~` J g nRRplR1hL N^NuNVH0&n$n Jg&k`$'JBL N^NuNV/ &nJg&k` SBB &_N^NuNVH0..&n $G GJf #2PB` G"P#K G& g/ NXO$j`L N^NuNVH0$n(.&.G1pp#3 / NXO,*g E!D D `'D n !J$ ׫~` J g l׳Rp lJ,g ~` J g l׳RplL N^NuNVHG3NjHxHxNvPON|J1 g,JRg$HyB*B-K/ NXO(BB/.N N .S// /.N$ ,lp`Jf` Vl// HkN Jg VmB o*B` 3:xfR`Rn/ Ї// N *` S 3:f`SJnJoS.` S 3:f`SJn rlN/Hy+(HsxN Jg6E W(/ VHs/ NP B2HЇ߮䟮`ݮ&n,.B` rn 3:xf V 3@f X*`j rn^ 3:XfVHx RHs RHsNf Jg6 R&` 3:8f`Rn  /Hs8HsXN `RnY / XHsHsxNr ` Sr `Hx/ /./. NLN^NuNV/./. N"PO/.Hy*HxN N^NuNVNHxHxNPOp1fHy*/NPO`Hy*HxNnPONzN^NuNVNJHx N~XONJf`4Jg& SJ2g S 2 g S 2 fS`Jg #gJg S 2\fS` ހ` ÊҀÊ ހno `pL N^NuNVH0&n$n `gp`RRSJfpL N^NuNV/ &n` Jfp`R :f R @ :fR R&_N^NuNVH0&n $n Ю.`RRnL N^NuNVH0$n &nBBBB  g  g  g  fR` +fR` -fp-@RB A\Dg Z_DJgm.` Ю k xRp0+b/./ / N* Jg .0n//.NPOB`D Ї0l6J1`fNp o/N./ .S/N `/NXORm .ܐ3@0oHx>/90/.Np R&kR g J1gbJ1`gNH .ѹ1xѹ1"910o #01L N^NuNVH0$np0** . R,/NXO&@Jfp`4B` j xxRn.`p xRn// / N L N^NuNVH0&n $np#3 'j&Jg S!KJg k ~` A1pJ g " f!RplJ,g(~` A1pp0+ C* l$E mT Am Zn .jf8( Aj,` D Am Zn Fg` RR Ff FJf`4S`, fp`@&S gR`p`2 k p0+ E`v n n n R pL N^NuNVHB`~` //N *RpnRmLN^NuNV/ &n KC1p 'y3<'y1'y3@&_N^NuNVH0$n &n.*,+ Tn й0lp`4**(+ Rn й0lp` ѹ3NXO` HxT^Hy(HxNtPO~3`Hy) HxN^PO~3`Hy)PHxNHPO~3`N2~M`Hy)HxN(PO~Hy)HxNPO`jHy)HxNPO~!Hy)HxNPO`FHy)HxNPO~Hy* HxNPO`"Hy*(HxNPO~Hy*DHxNPOpg:J1$f2JgHy*`HxNPO`/91PHy*zHxNl p>fB//N\POHxHxNTPOpgJ1$fHxLHxN2POHx5HxN*PON`N&LN^NuNV/ GRnDB3hpL N^NuNVH0&n$n / NXO&@Jg8Hx/ / N Jg" +#fHnHkN>POJg .```pL N^NuNVH0&n$n / NXO&@Jg&Hx/ / Nf Jg +:fp`p``pL N^NuNVH0&n$nB/ N^XO&@JgHx/. / N Jg +=fVB 0m 9n KRHH0( :gvlnJfp` ^f.RJg :fp`| R KRHH¼`, \fRH@m^@mgY@gQ@gXY@gdU@fgx@mfg@k @ nH0;N|||||||| @0fp` Rr fr `8 k "n E k p0+C, m6 nf(* ..` G"Eg` RR Gf GJf`R`.&kR g fp`$k k p0+C, ` k "n UE k p0+C, l$F m4 nf&* ..` G"Eg` RR Gf GJf`0S`* fp`<&S gR`p`. k p0+E` n n n R pL N^NuNVH*.GJg.B`N.pAn rZm pfr `p n/NXO mg:SgHUfgR1k n|H0;NJJJJJJJJJ|Hy*HxNPO``BHy*HxNPO`NHHм `HH.p0nr9m0`panrfm Wv``Hx /N П, Ї(RR`Jfp`P A\Dg Z_DJgHHм `HHrhf,R`Jgp` .g"D`"$ L N^NuNVN^NuN>NNN;VN 0N־N NN `NкN NՂNN NhNlNȨNN.NȊN+NtN NiNi8NǠNNN-NVH0$n G#+H/ HnN PO.JfHnBNpPO.Jg/.N.NXO`pBNXOHn/.NHPO.Jg/.N.NXOHn/.N(PO`:/.NBBJ g " f!RplL N^NuNVH0$n~&y2P g g&kR` L N^NuNVH0$nG1pp#3 / NXO,Jg R!jJg j f'j f'j~`* J g" fB B 逼lSRp lJ,g8~`. J g"" f B BB 逼lSRplS f'j f'RS1hL N^NuNVH0*.&n E1pp#3 E E!kJg k `%E'E/ NXO,R~` J g lRRp lJ,g ~` J g lRRplR1hL N^NuNVH0*.&n E_DHH*VDgJVDHHLN^NuNVHxHxN ,PON 2N Hy*HxN POHxNtXONrN^NuNVH,.&n *Jl D,B R/Hx N r0ҟ/Hx N \,nJl Rr-B3x/ N XOLN^NuNVH&nB/ NXOS,`3xHH*hxhRSnLN^NuNVH&nBBB 3+xfR` 3-xfRz`Hx /N 3xHHП0,R 30xm 39xoJg D` LN^NuNVHxHxN PON 91LA1(/0Hy+HxN ^ p#1$N^NuNVH0$n&JgR` L N^NuNVH0&n$n fHnHx BN E/91hHy*HxN /93Hy*HxN /93Hy*HxN &_N^NuNVJgp3gJ1$f Hy1pNXO/91/93A/NXLDXNuaaaaaaaaNV-nHnHxFNPON^NuH $oL /N@QHUH@  @   $P@ @  @ " $D$ D@ A"  @ @ "R A``v .X @$PB-J`R .R @f g o(. .֐-@"¼f .SJo "R A` SJg R @"JR` .SJo "R A`` ` R @` R @` L N^NuNVH0&n $n .SJggrt `RR`pL N^NuNVH0$n &n` Jfp`RRgHHHHL N^NuNVH0$n &nBBBB  g  g  g  fR` +fR` -fp-@RB A\Dg Z_DJgHHм `HH.p0nr9m0`panrfm Wv``Hx /Nl П,   IBA@B@"B@@@  "@ "@ $$ H @  @ @@H @ @"@  $I$I$I$I$I$ $@@BBB "@"   $"@@ "@ $ @  $@ ! $@ @@ $$"$"B  L N^NuNVH0&n E%n/ HxNPO.Jg `pL N^NuNVH0$n G'n'J'n / HxNpPO. n L N^NuNVH0G$n'n'n 'J/ Hx N0PO.Jg `P . SkF n>H0;N$$$$$$$$$*6666**$$ ` + ሀ$pL N^NuNVH0G$n'n'n 'J/ Hx!NPO.Jg `P . SkF n>H0;N$$$$$$$$$*6666**$$ ` + ሀ$pL N^NuNVH0&n $n-J-KHnHx$NPOL N^NuNVH0G$n'n'n / Hx(N@@$  ! $I$I$I$I$I$ BP@JH H$D@B"@D" $@ %)HIB $ "AR@H!$@$D@"AR@B B @$ B@$I$I$@H"P@ @@D !@ !@ B $@I$I$I$I    $I$I$I$  rucntehijkwvafmsgxblyd1opz%sEditing file: %s ...File too big for the av[e] [r] E R [%1ld] %sMove: [r] R EQVR %ld %5ld Substitute: [eqvr] , EQVR [%1ld] %s, %5.5ld (y/n) %5.5ld "%s" --> "%s"%5.5ldCouldn't find "%s"Zap: [alrst[p] type PROGRAM WORD PROC [r] recd OFF ON DEBUG [s] sync OFF ON [t] tabs COMPRESSED EXPANDED NO CHANGE [x] xonofOFF ON [ ] file SINGLE MULTI 81Q68010 XPU 151 Cromix-Plus Editor source 1.66.7 Copyright (c) 1986 Cromemco, Inc. (L(P(T(X"#! (\(`(d(h(l(p(t(x(|(((((((((((READ_ENV: cannot allocate memory CENVCENV entry not found in environment file Cannot open ENVIRONMENT file %s .ce- --> Sorry, but this makes no sense at all (non-existing file and READ ONLY mode). File "%s" does not exist, so it cannot be edited into "%s" New filerFile "%s" does not have READ access wNo WRITE access - mode set to READ ONLY ! .bakFile "%s" already exists - delete (y/n) ? awwFile access denied - command aborted ! spoolFile %-20s %5.5ld "%s" changed since last save ! Update nevertheless ? (y/n) Y - Press RETURN key to continue rwarwIll<egin, ursor, nd, , Command illegal in the READ-ONLY mode. COMPILER: %stc=r/etc/passwd/dev/+`+d+h+lsh-csh-c        Unexpected signal number %ld Tailable memory Lines too long - truncate (Y/N) ? %ld lines (%ld bytes) read %ld lines (%ld bytes) written to file "%s" File "%s" left unchanged Usage: CE [-rucnetijkwvafmsxzbl] [] [a] alignRIGID ELASTIC [b] bell OFF ON [c] pos OFF ON [d] step 8 [e] lmarg1 [f]] .A R T Zapping line Wait ...Zapping line Wait ...%2ld Begin Cursor End Previous Warning - illegal marker ordering. Zap the selected area (y/n) ? Beautify: Write: [ar]A R Write [%lc, ce%ld] (append) (raw) to file: File "%s" already exists. Delete (y/n) ? aw%ld lines (%ld bytes) appended written to file "%s" Indent [p]: Begin Cursor End P Line ColIndent: <--, -->, or ESC .ce$"Shell: Exit (or Cntrl-B /etc/termcaps>Exit: Quit or Terminate "%s", >Exit: Update, Quit, Terminate or Continue "%s", WARNING - file was changed - confirm command (y/n) QUITTERMINATEWARNING - file was not changed - confirm UPDATE (y/n) UPDATECompiler Jump: %2l_env../.ce_env/etc/ce_envINITIALIZE: cannot allocate memory Cannot open TERMCAP file %s Cannot read terminal capabilities Missing: "%s" Missing: "%s" Insufficient terminal capabilities %s > ! "# )cmclcecddlalocfcctimeipipeicdcpdndnbwowfilirwiwecoliupdososersamkdkuklkrsqsdswbaxskEisalblcudilmrmpiheinjukaltmorlptrssytaxofiSTEP Next command: egal file access test: %s \n File "%s" not found! File "%s" not readable. File "%s" incorrect. File "%s" not found. /usr/lib/ccterrs/usr/lib/pascterrs/usr/lib/ftncterrsWindow not at zero WARNING - No memory available ! Press ESC and immediately save the file Free list corruption - p = %08lx Bad pointer: %08lx Copy: [r]R %5ld Find:                I0&p rmarg66 [g] para 5 [h] head NORMAL HIGHLIGHTED[i] indenAUTOMATIC MANUAL [j] just OFF ON [k] case TOGGLE TO UPPER TO LOWER [l] ltermLF CRLF [m] mode READ ONLY UPDATE [n] rstl 10 Z) will return to CE shell''''''''''''''''''''(((( ((((( ($(((,(0(4(8(<(@(D(Hd Begin Cursor End Previous Line %2ld Next Previous ine : Case: %s [Begin Cursor End%2ld] ESC List: [n] %2ld Begin, Cursor, End ESC numbered, Read file: File "%s" does not exist File "%s" not ordinary r%ld lines (%ld bytes) read Cannot set marker outside the lineSetReset marker: %2ld * (A %s %sCE modes: [%lc] %sEnter new value: %sVerify [ar] [%2ld] ESC A R Window at %4ld, <--, -->, /, ?, # or ESC: <- Edit: Again Copy Delete Exit Find Insert Other Jump Move Page Substitute Xchng Zap Other @ %% Home List Read Verify Yank Write Other Insert: Delete: Word Xchange: Xchange word only Line Col File: %sUsage: Lines %7ld Bytes (file) %8l,d Bytes (memory) %8l,d%02lxH> ./bin/chowner.bin 7442 77777 77777 5723 4007577116 7500 0200#NVtH0N&n EBpfHy NXOHy BNPO`bXJg\BB/ /N .JgB//HxN|`.Hy /N~PO/HntN:POHnt/NPO/N XO` L N^NuNVH0G$n/ NXOkkk/ N0XOSkkL N^NuNVH0E&n / Hx /.N p*(@p*.@p,zplU` SHx /NB S/HxNd ПHx/N&HxNNПHx/NHxN:П/HxNX R@jjjL N^NuNVH0$n&n JR  g  g  g  g :gR m L N^NuNVH0$n &n`Jfp`RR A\Dg Z_DJgHHм `HH-@ A\Dg Z_DJgHHм `HH".g A\Dg Z_DJgHHм `HH-@ A\Dg Z_DJgHHм `HH". L N^NuNVN^NuHop0//NP6N@FNuNVH0| n $p" g JR -fgR -f`J*WDHH* JRHH.JgtpA_Dg rZ\DJg м ` .&n`Jf`J\HHfJg`6J+fp'@`Jg n R'pJ ".ڒ-A f~ g: 0f4SJm R @ R"@p`/ R @HH/NZPO .SJo.SJm R @ `/ HH/N"PO`A o6SJm R @ R"@p`/ R @HH/NPO` .SJo.SJm R @ `/ HH/NPO``2z .X @.B-G`R .R @f g o&. .ڐ-@"¼f: .SJo.SJm R @ `/ HH/NPO` SJg6SJm R @ R"@p`/ R @HH/NPO` .SJo.SJm R @ Nu @@ tgv/etc/group/etc/passwdBad group Bad owner %s Usage: Chowner [-gv] ownername file ... @(#)chowner.c 1.4 (1/8/87)1Q68010 XPU 151 Chowner source 1.4 Copyright (c) 1986 Cromemco, Inc. g0+Hr.g`` `Jf@HxNXO'@Jg&k &'| R @ `p7@``$k`0+Hr.g`L .ÊҀÊHn // 0+H/NP7@J@f&'| R @ `BB0+H/HxNnpL N^NuNVB/.HnBNJgp` .N^Nu"/g@ o/4|gSH4H@04<A` Qd`QNu$/ gL o"o02 |f|g `&|g SrB`"Qd$`QdNu$/ g o"o`QNu"/g8 o4|gS4<A` Qd`Q2  NVH0N&n EB/ HyNPO-@Jg ËҀË``2Jf`*HxgHyNPOJgHp$/HyN PO-@Jl*Hn/NPOJfHy.HxN POHxNXO`N/Hy"NPO$Jl(/ /NXPOJfHy:HxNPOHxNnXO/Hy"NPO-@XJgtHxvHyNPOJg/HyFHxN BJm/Hx/N .Jm/.Hx/N .JgB//HxNX|` `HyJHxN&POpL N^NuNVdH0Ed&np-@BBHn/ N.JgB/ /HxN`HnHx-H a\Dg z_DJgHH `HH nJgR`L N^NuNVH0HnHy /.N $@JgHnHy HxN &@JgvB~8/ HxHnN JgRRp8l0SJm R @p ` / Hx NPO/. / N^PO~HnR/Hy / N`/ NXO`Hy HxN PO/ NpXO`Hy 2HxNPOL N^NuNVH0$nG /. Hy / N pмl/p+/p+A`/0p+C/1Hy / N\p+/p+/p+/Hy / N4L N^NuNVN^NuHop0//NP6N@FNuNVH0$n &nf` `~`< `pL N^NuNV/ &nHH g\` +&_N^NuNVH0$n &nBBBB  g  g  g  fR` +fR` -fp-@RB A\Dg Z_DJgHHм `HH.p0nr9m0`panrfm Wv``Hx /N\ П, Ї(RR`Jfp`P A\Dg Z_DJgHHм `HHrhf,R`Jgp` .g"D`"$ L N^NuNVH0$n G'n'n'n / Hx NPO.Jg `$pL N^NuNV-nHnHx NPON^NuNVH0$n G'n'J'n / HxNPO. n `/ HH/NPO``.`,SJm R @ `/ HH/NrPO`,SJm R @ `/ HH/NDPO`L N^NuNVH&nJk gP/ NXO.0+ HgHx/+N8POBBk pH'@2+H/NXOJgp` `pLN^NuNVB/. HnHxNxN^NuNVH0&n$n Hx/ NPO rfp7@ ` wfp7@ ``"Hn/.NPOJg`7nB `Bk pL N^NuNVH0&n0+ Hfp`0+ Hgp`tJfp`j$k`20+Hr.gBB0+H/HxNhp`< .ÊҀÊHn // 0+H/./bin/clist.bin 7442 77777 77777 12715 4007577211 7164 0NuNVH0$n G'n'n'n / Hx NPO.Jg `$pL N^NuNVH0&n E%n/ Hx NPO.Jg `&pL N^NuNV-nHnHx NPPON^NuNVH0$n G'n'J'n / HxN PO. n L N^NuNVH0$n G'n'J'n / HxNPO. n L N^NuNVH0&n E%n/ HxNPO.Jg `pL N^NuNVH0G$n'n'n 'J/ Hx!NdPO.Jg `P . SkF n>H0;N$$$$$$$$$*6666**$$ ` + ሀ$pL N^NuNVH0&nEHnp/.N.JfJ .ApB0/ HxHnpNR rf$/. /NPOJfHn/*NPOJg``/.NJXOJgpgBB/HxNd .L N^NuNV\H0E\&np-@BBHn/ N.JgB/ /HxN`HnHxHnl/.N.JfV .AlB0/ HxHnlNr rf0Hn/*NPOJg .찮 fHn/* NPOJg``/.N^XOJgpgBB/HxNx .L N^NuNVH0&nJg *g ;fp`B`z  g  g  g  fR`Jf`^ n !Jf` KR :f S$@`BS n " mA-H JRgh %f0B -fR 0fRz0`z B`"Hx /.N | JRHHП0-@ 0m 9o .fPO7@J@g0+Hr.g`~` `Jf"HxNXO'@Jgk `p7@`N/ Hx&/+0+H/N\7@J@g0+Hr.g`Jg``S'R R @p`,k 0+HrgBB0+H/HxNpL N^NuNVH0&n ..R0+ Hfp`0+ Hg0/0+H/NPO7@J@ / Hx0NPO.Jg `j jjpL N^NuNVH0E&n/ Hx2NPO.Jg `j jpL N^NuNVH0$n G'n'R'n 'n/ HxPNFPO.Jg `$pL N^NuH0/2/ AH@B@2/Ё/@L.Nu//lD//lDa:Jo lDJolD/_.Nu//lD//lDaJo lD/_.Nua.Nua /o.NuJof&/p0/?@0/?@H@?@ NuH$/r2/0/R@eL?A2/?A"/ /2/2/HABAdS@ԯ/@/BLNu/A2/`H $oL /N@Q @ HhUsage: Clock [-h]  Execution time:realCPU %02.2ld:%02.2ld:%02.2ld%5ld.%1ld (%s)@(#)clock.c 1.7 (12/23/86)shell-c)C1Q68010 XPU 151 Clock source 1.7 Copyright (c) 1986 Cromemco, Inc.  TI ./bin/clock.bin 7442 77777 77777 4730 4007577313 7122 0Jfp`f  8o 9 8` <# 8Hxm/ N DPO$@Jg2Hy 4/ N POJfp`p 4l"9 4`p"# 4pL N^NuNVH0&n$n B/ N.NXO +g `/ NXO. *g `/ NXO,JVDfJVDJgxJg^JgZ G"F0Qf FHh GHhN PO` G0H F2HJf* G0H"Ҁ// NPO F0H"Ҁ// NPO`z/ / NlPOJg``PJfJg/+/ NFPO/*/ N:PO L N^NuNV/ &np'@ B'S"9 8ғ'A&_N^NuNVH0$n&jA, мoHy HxN|POHxNXO j0( HfHx//*N g\` +&_N^NuNVH0&n$n JRgR` L N^NuNVH&np<,p+.rc  S`WHxm/N П"Ёr+ЁABHxHn/ N.p7@ ` BHxHn/ Nz.p7@ `~JgBk p` 7nB L N^NuNVH0&n0+ Hfp`0+ HHUHHLNu /"/N@UHHNu"_" _N@UHH//N"/ / o "oN@UHHNu@@ @ " -----rw%5d %s Cannot open output Cannot open input !!!!!$!,!6!<./bin/cmpasc.bin 7442 77777 77777 12637 4007577410 7320 020{NVHN&n / HyNPO-@Jg ËҀË``4NL,Nf./ NXO*N6,NN.//NPO `HyHxNPOpLN^NuNVHnHxBN$ .N^NuNV/ G/ NFXO V/N.NLXO&_N^NuNVH0&nE `HyB// NPO/NPO$@XJfBBHnHy2N.JgBB/HxNh`BHnHnHnBN<.JgBB/HxN8` .gr` .". L N^NuNVHyDHxNPOHyTHx /. NtN4POHyZp2Ю/HxdNNPOHy^HxN .Jfp`f F S 0 fSJ ,gJg F S 0 fS F RB0J 0g /NXO. V60H" Ҁ%AR L N^NuNVH0&n$n SJg>SJm R @p`/ NXO.rg JR  f``B L N^NuNVH0$n&JB,`^  f P,`H  fR`> Pm KRp "P¼.`ܼo KRp R` KRRRRf Pm KRp "P¼.`ܼo KRp R` KRB L N^NuNVH0,.*. /NXO&@Jf/NXOJg`p`/NXO$@Jf/NXOJg`p`// H0$nG'J'n'n/ HxHNHPO.Jg ` n pL N^NuH0/2/ AH@B@2/Ё/@L.Nu//lD//lDa:Jo lDJolD/_.Nu//lD//lDaJo lD/_.Nua.Nua /o.NuJof&/p0/?@0/?@H@?@ NuH$/r2/0/R@eL?A2/?A"/ /2/2/HABAdS@ԯ/@/BLNu/A2/`H $oL /N@QHUHHLNu /"/N@UHHNu"_" _N@UHH//N"/ / o "oN@UHHNu @@@gp`tJfp`j$k`20+Hr.gBB0+H/HxN4p`< .ÊҀÊHn // 0+H/N7@J@f&'|pL N^NuNVH0&nER0+ Hfp`0+ Hg./ 0+H/NPO7@J@g0+Hr.g`~` `Jf"HxNXO'@Jgk `p7@`N/ Hx&/+0+H/N7@J@g0+Hr.g`Jg``S'R R @p`,k 0+HrgBB0+H/HxNpL N^NuNVH0| n $p" g JR -fgR -f`J*WDHH* JRHH.JgtpA_Dg rZ\D!D!N!T!Z!^!d!j!r!|!!File %-20s %s, %s %d, %d %02.2d:%02.2d:%02.2d @(#)clist.c 1.2 (12/22/86)Illegal SundayMondayTuesdayWednesdayThursdayFridaySaturdayNoneJanuaryFebruaryMarchAprilMayJuneJulyAugustSeptemberOctoberNovemberDecember1Q68010 XPU 151 Clist source 1.2 Copyright (c) 1986 Cromemco, Inc. *20LX&NVH0N\*. G PO,Jg  ڀ``N*Jg`pg` E'P E%h/9 8N ^XO&Jg/9 8N JXO$JgHnHy /+NV '@JgvHnHy /*N8 %@Jg4/ / NxPO.f/*/+Hy HxN4/*NpXO`/*Hy tHxN ~/+NLXO`/+Hy tHxN ~`Hy HxNPO~ `Hy HxNPOpL N^NuNVH0G Hxl/ N PO# (Hxr/ N PO# ,Hxt/ N PO# 0Hxb/ N PO$@Jg6Hy 8/ N POPON^NuNVH0..$n GHy`HxNPOHxhHyNPOJgp Z/Hx N*-_/.HxpL N^NuNVH0| n $p" g JR -fgR -f`J*WDHH* JRHH.JgtpA_Dg rZ\DJg м ` .&n`Jf`J\HHfJg`6J+fp'@`Jg n R'pHnHxFNPON^NuH $oL /N@QHUHHLNu /"/N@UHHNu"_" _N@UHH//N"/ / o "oN@UHHNuH @@    "@@ @  !(lrtmb |qtCannot open file: "%s" rrUsage: Compare [-qt] file1 file2 %06lx: %02lx %02lx @(#)compare.c 1.4 (12/23/86)%s matches %s exactly %s doesn't match %s %s is shorter than %s %s is longer than %s 1Q68010 XPU 151 Compare source 1.4 Copyright (c) 1986 Cromemco, Inc. @2  `NVH0N &n / HyNPO,Jg ËҀË``pg`HxtHyNPO#HxqHyNPO#HnHyF/N& $@Jg|HnHyH/+N *Jg>// NPO.fJf /+/ A6/0HxNRJg~`/+HyHxN4 ~/ NXO`/HyHxN ~ `HyJHxNPOpL N^NuNVH0&n$n B*SJm R @p`/ NXO.SJm R @p`/ NzXO,fJm`4`8Jl`2Jl`,Jgp`6///HylHxNbzRH&nB`Hx /NHH0П.R 0m 9o A\Dg Z_DJgHHм `HHJg g_f/HxN.``B LN^NuNVH&n BBB/.N HnHx / /.NJf*p f"r2 WDfr2 WDJf~ LN^NuNVH&n BB/.NB HnHx / /.N.JgBB/HxN@~ LN^NuNVN^NuHop0//NP6N@FNuNVH0| n $p" g JR -fgR -f`J*WDHH* JRHH.JgtpA_Dg rZ\DJg м ` .&n`JfB/.HnBNvJgp` .N^Nu"/g@ o/4|gSH4H@04<A` Qd`QNu$/ gL o"o02 |f|g `&|g SrB`"Qd$`QdNu$/ g o"o`QNu"/g8 o4|gS4<A` Qd`QNuNVH0$n G'n'n'n / HxNPO.Jg `$pL N^NuNVH0$n G'n'n'n / Hx NPO.Jg `$pL N^NuNV-nHnHx NTPON^NuNVH0$n G'n'J'n / HxN$PO. n Jf` `~`< `pL N^NuNV/ &nHH g\` +&_N^NuNVB/.HnBNvJgp` .N^Nu"/g@ o/4|gSH4H@04<A` Qd`QNu$/ gL o"o02 |f|g `&|g SrB`"Qd$`QdNu$/ g o"o`QNu"/g8 o4|gS4<A` Qd`QNuNVH0$n G'n'n'n / HxNPO.Jg `$pL N^NuNVH0$n G'n'n'n / Hx NBPO.Jg `$pL N^NuNV-nCannot open file "%s" %s matches %s exactly rrInsufficient memory Usage: Cmpasc [-l] [-r] [-t] [-m #] [-b #] file1 file2 Too many nonmatching lines -----> %s %6ld %s @(#)cmpasc.c 1.3 (12/23/86)1Q68010 XPU 151 Cmpasc source 1.3 Copyright (c) 1986 Cromemco, Inc. ./bin/config.bin 7442 77777 77777 4536 4007577571 7306 0`~Jff ` Jlp`pL N^NuNVN^NuHop0//NP6N@FNuNVH&nJk gP/ N&XO.0+ HgHx/+N8POBBk pH'@2+H/N^XOJgp` `pLN^NuNVB/. HnHxNN^NuNVH0$n&nHx/ N:PO n H@gF@g[@fZgBBHn/ N.p7@ `>BHxHn/ N4.p7@ ` BHxHn/ N.p7@ `~JgBk p` 7nB L N^NuNVH0&n0+ Hfp`0+ Hgp`tJfp`j$k`20+Hr.gBB0+H/HxNp`< .ÊҀÊHn `J\HHfJg`6J+fp'@`Jg n R'pJf` `~`< `pL N^NuNVH0$n &n` Jfp`RRgHHHHL N^NuNVH&n~` KRpf ` R o . LN^NuNVH0&n$n JRgR` L N^NuNVH0$n G'n'n'n / Hx NPO.Jg `$pL N^NuNV-nHnHx NPON^NuNV/ G'n'n 'n / HxNPO&_N^NuNVH0$n G'n'J'n / HxNPO. n L N^NuNVH0$n G'n'J'n / HxN@PO. n L L N^NuNVH0$n G'n'J'n / HxNPO. n L N^NuNVH0&n E%n/ HxNPO.Jg `pL N^NuNVH0$n G'n'R'n 'n/ HxPNbPO.Jg `$pL N^NuH0/2/ AH@B@2/Ё/@L.Nu//lD//lDa:Jo lDJolD/_.Nu//lD//lDaJo lD/_.Nua.Nua /o.NuJof&/p0/?@0/?@H@?@ NuH$/r2/0/R@eL?A2/?A"/ /2/2/HABAdS@ԯ/@/BLNu/A2/`NV-nHnHx NPON^NuNVH0$n G'n'J'n / HxNPO. n L N^NuNVH0$n G'n'J'n / HxNPO. n L N^NuNVH0&n E%n/ HxNjPO.Jg `pL N^NuNVH0$n G'n'R'n 'n/ HxPNPO.Jg `$pL N^NuH $oL /N@QHUHHLNu /"/N@UHHNu"_" _N@UHH//N"/ / o "oN@UHHNu @./bin/compare.bin 7442 77777 77777 5712 4007577500 7454 02 ,pwNVXH0N<&n EX/ HyN*PO-@Jg ËҀË`` Jf`Hy /HnN B +gp`p/HnxHnNR.JgBHn/HxN`/ /.xNPO.JgHnHyHxN ~`tJgP/+NXO%@Jg$ <Ъ%@/ /.xNPO.`/+Hy:HxN. ~`/*HxN2HyLHxN /.xNXO `HyfHxNPOpL N^NuNVH0$n&n Hx/ NPO,Hx/ NPO.l"/ HsNPOJf/ /.NPO`/ / /.NPO/NPOL N^NuNV  N^NuH0/2/ AH@B@2/Ё/@L.Nu//lD//lDa:Jo lDJolD/_.Nu//lD//lDaJo lD/_.Nua.Nua /o.NuJof&/p0/?@0/?@H@?@ NuH$/r2/0/R@eL?A2/?A"/ /2/2/HABAdS@ԯ/@/BLNu/A2/`H $oL /N@QHUHHLNu /"/N@UHHNu"_" _N@UHH//N"/ / o "oN@UHHNu@@@/NPOrf`R m L N^NuNVH0&n0+ Hfp`0+ Hgp`tJfp`j$k`20+Hr.gBB0+H/HxN p`< .ÊҀÊHn // 0+H/N7@J@f&'|pL N^NuNVH0&nER0+ Hfp`0+ Hg./ 0+H/NfPO7@J@g0+Hr.g`~` `Jf"HxNXO'@Jgk `p7@`N/ Hx&/+0+H/N7@J@g0+Hr.g`Jg``S'R R @p`,k 0+HrgBB0+H/HxN pL N^NuNVH0&n ..R0+ H2@YNVH0N*. E /A &H/N PO-@Jgڀ``RHxf/ NPO#0Hxa/ NPO#0Hxs/ NPO#0Hxl/ NPO#0 Hxu/ NPO#0Hxt/ NPO#0Hxb/ NPO#0Hxp/ NPO#0Hxr/ NPO#0 Hxg/ NPO#0$Hxe/ NPO#0(Hxi/ NPOJg Hy0,Hxi/ NPO/N POJf`tHxo/ NPOJg Hy00Hxo/ NPO/N POJf`FJ0,f 90grP` <"#0,J00f 90$grP` <"#00 E.gHy X @/N JPOJfB E,gHy X @/N *POJfBJgHn,/N&XO&@Jfp`& X/N6XO`L N^NuNVB/.HnBNzJgp` .N^NuNVH0$nYJ"g y"&h "o#"` "l o #"&k` y"!J%K&y" Гf k ѓ k'h`&k Гf k ѓ k'h`#"` #"%JL N^NuNVN^Nu"/g@ o/4|gSH4H@04<A` Qd`QNu$/ gL o"o02 |f|g `&|g SrB`"Qd$`QdNu$/ g o"o`QNu"/g8 o4|gS4<A` Q&n Ю $@`. a\Dg z_DJgHH `HHR n . L N^NuNVH0$n&n Ю ,B`:  f l Rr `` f`l R``Rn L N^NuNVH0(.$n&. Ю*&DBof 2 hfL.` 2 xg`Ro "恲g "恲go KRp ,`o 2 xf,`o KR R` L N^NuNVH0&n..$n o.. // / N L N^NuNVH0&n Ю$@ . ËҀË`p R n .L N^NuNVH0&n Ю $@`HHA!R n . L N^NuNV@!B @ ."8faslutbprgeioCannot open: %s Convert [-faslutbprge] [-i i_len] [-o o_len] [[infile] outfile] --rrww        $.binFile %s is not a legal 68000 bin program Illegal size: %s Allocated memory: %l,dK Usage: Config pathname [size[d,k]] @(#)config.c 1.2 (12/23/86)څ1Q68010 XPU 151 Config source 1.2 Copyright (c) 1986 Cromemco, Inc. fp`0+ Hg0/0+H/N HPO7@J@g0+Hr.g`` `Jf@HxNXO'@Jg&k &'| R @ `p7@``$k`0+Hr.g`L .ÊҀÊHn // 0+H/Nx7@J@f&'| R @ `BB0+H/HxNpL N^NuNVH0| n $p" g JR -fgR -f`J*WDHH* JRHH.JgtpA_Dg rZ\DJg м ` .&n`Jf`J\HHfJg`6J+fp'@`Jg n R'pJf` `~`< `pL N^NuNV/ &nHy /N `HnHy BN< &JgrJgHnHy /Nn `HnHy HxN -@Jg/./NpPO(/.NXO`/Hy XHxN x/NXO`/Hy XHxN x `Hy jHxNPOHxN^XOL N^NuNVH0 90gAr"`A "* 90gAH"` 90gA"`A, "(/90,N LXO&@Jg 900T/N 4XO$@Jg/./90,/ EN .JmJ0g // NPO.J0g // NPO.J0 g // NPO.J0g // N>PO./900/ // DN.J0g/900// N .J0(g // Nd`QNuNVH0$n G'n'n'n / HxN PO.Jg `$pL N^NuNVH0$n G'n'n'n / Hx NPO.Jg `$pL N^NuNVH0&n E%n/ Hx NPO.Jg `&pL N^NuNV-nHnHx NTPON^NuNVH0$n G'n'J'n / HxN$PO. n L N^NuNVH0$n G'n'J'n / HxNPO. n L N^NuNVH0&n E%n/ HxNPO.Jg `pL N^NuNVH0$n G'n'R'n 'n/ HxPNbPO.Jg `$pL N^N^NuHop0//NP6N@FNuNVH&nJk gP/ NXO.0+ HgHx/+N8POBBk pH'@2+H/N nXOJgp` `pLN^NuNVB/. HnHxN N^NuNVH0$n&nHx/ N PO n H@gF@g[@fZgBBHn/ N n.p7@ `>BHxHn/ N .p7@ ` BHxHn/ N.p7@ `~JgBk p` 7nB L N^NuNVH0&n$n Hx/ N^PO rfp7@ ` wfp7@ ``"Hn/.N POJg`7nB `Bk pL N^NuNVH0$n&nB`8SJm R @"JRp`/ JRp        c.<(+|& !$*);^-/ |,%_>? `:#@'=" abcdefghi jklmnopqr ~stuvwxyz [ ] {ABCDEFGHI < + }JKLMNOPQR \ STUVWXYZ % 0123456789: 7-./% <=2&?'"5@Z{[lP}M]\Nk`Kaz^L~no|_myjС@(#)convert.c 1.2 (12/23/86)1Q68010 XPU 151 Convert source 1.2 Copyright (c) 1986 Cromemco, Inc. ./bin/convert.bin 7442 77777 77777 15073 4007577713 7535 0HH g\` +&_N^NuNVH0$n &n` Jfp`RRgHHHHL N^NuNVH0$n &nBBBB  g  g  g  fR` +fR` -fp-@RB A\Dg Z_DJgHHм `HH.p0nr9m0`panrfm Wv``Hx /N П, Ї(RR`Jfp`P A\Dg Z_DJgHHм `HHrhf,R`Jgp` .g"D`"$ L N^NuNVH0..E"por` X"¼Ё".JgD&R&k* n. Pn Г&@&` R!k fBA `<$&kf мPO.J0$fJ0 g Rr  Rr /. // N ``BB|P/HxNN L N^NuNVH0$n,.&F`:SJm R @p`/ NFXO.Jm KR` fp`` S J f L N^NuNVH0$n,.&F`LSJm R @p`/ NXO.Jl fp`*`$p f`Jgp f` KRS J f L N^NuNVH0&n Ю $@`pA R n . L N^NuNVH0$n Ю &@` + g`S m L N^NuNVH0&n Ю $@`. A\Dg Z_DJgHHм `HHR n . L N^NuNVH0NuH0/2/ AH@B@2/Ё/@L.Nu//lD//lDa:Jo lDJolD/_.Nu//lD//lDaJo lD/_.Nua.Nua /o.NuJof&/p0/?@0/?@H@?@ NuH$/r2/0/R@eL?A2/?A"/ /2/2/HABAdS@ԯ/@/BLNu/A2/`NV-nHnHxFNPON^NuH $oL /N@QHUHHLNu /"/N@UHHNu"_" _N@UHH//N"/ / o "oN@UHHNu H @@@@@   I04? g *" fjN`jN`N L N^NuNVH0&nJQg/9QNZXO$@Hj/ N0PO0+ gSk R @p`/ N.zXO-@0+ gSk R @p`/ N.VXO".-A0+ gSk R @p`/ N.,XO".-A0+ gSk R @p`/ N.XO".%A(pйQ %@0 . %@,`N L N^NuNVH0,. &nJQgHn/ NBPO/9QHnN PO.  /HxN5, SJg/9QN zXO$@%yQ$0+ gSk R @p`/ N-FXO-@0+ gSk R @p`/ N-"XO".Ԃ-A0+ gSk R @p`/ N,XO".PHxNAPOpL N^NuNVH0$n &n/ NPXO,/ NFXO./ /.N3PO*l/ " Ҁ/N3POJf/./N3POL N^NuNVH0$n&J`Rf L N^NuNV/ /.N4TXO&@Jg `HyP&n0+ gSk R @p`/ NXO.Jgz n -H0+ gSk R @p`/ NXO-@0+ gSk R @p`/ NXO".-A0+ gSk R @p`/ NXO". n L N^NuNVH0&nEQJQgJgNt` /9QNXO$/9QNXO#Q RHh/ NPO yQHh / NPO yQ-H0+ gSk R @p`/ N5XO-@0+ gSk /9QHnNPO%@,`NL N^NuNVH0,. &nJQgHnHn/ N X/9QHnNPO./HxN., SJg/9QNxXO$@%yQ$0+ gSk R @p`/ N&DXO-@0+ gSk R @p`/ N& XO".-A0+ gSk R @p`/ N%XO".-A0+ gSk R @p`/ N%XO".%A(%G,j2`4`NL N^NuNVH0&n yQ 9Q Hx GHh Hj,N3( B%G *= g *QHxN) HxN)jXON^NuNVH0$nHx(NnXO&@& %K L N^NuNVH0$nHx0NBXO&@&$%K$ L N^NuNVH0$nHx6NXO&@&(%K( L N^NuNVH0$nHx4NXO&@&,%K, L N^NuNVH0$nHxPNXO&@&0%K0 L N^NuNVH0$nHxNVdH0N4|&n / HyPN4PO-@Jg ËҀË``Jf`HyPzHxNC`POHyP HnHyP/NHyPHnHyP/NnHyPHnHyP/NTBBHnxHnN?.JgBHn/HxNB`HxHx/.xN5> ,/NXO$@/ NBHxHntHnN>.JgBHn/HxNB`4HxHx/.tN4 */// N$: /N6\.tN?,XO/N6L.xN?XOHxmHyPN4POJgLHxHnpHnN>f .JgBHn/HxNB`/ /.pHnN" /.pN>XO `HySk R @p`/ NXO".肀.0+ gSk R @p`/ NXO-@0+ gSk R @p`/ NXO".䂀-A0+ gSk R @p`/ NXO".-A0+ gSk R @p`/ NXO".܂*0+ gSk R @p`/ NXO-@0+ gSk R @p`/ NXO".؂-A0+ gSk R @p`/ NXO".Ԃ-A0+ gSk R @p`/ NXO".Ђ, yQ-H0+ gSk R @p`/ NXO-@0+ gSk R @p`/ NXO".Ȃ-A0+ gSk R @p`/ NXO".Ă-A0+ gSk R @p`/ NXO". n!A@L N^NuNVH0R @p`/ N4XO".-A0+ gSk R @p`/ N4XO".-A0+ gSk R @p`/ N4XO". n!A2 yQ!R yQBh, yQ (@Q f yQ!RHx / N"POBp$xR H/Hx N%p0Пx H : Hn`Hx // N! L N^NuNVH0,.B F$h4`:J$f F/((HjNPO%@$J$fHjHyQDHxN&F ~$R f F&h,`VJ$f F/((HkNzPO'@$J$fHkHyQ^HxN& ~` k$0(,Hrf k$p1@,&S  k$"h0)*H// N(`z+3V@g k$"k4 (gZ k4 +8Ш./ k4"h0)*H/+3g <@`p0/ k$ +(Ш./ k$"h0)*H// NL N^NuNVH0$n &n0+ gSk kP R @Bp` / BN0PO0+ g.Sk kP R @-H/ NXOT n`/ / NXOT/NPO/ / NPOL N^NuNVH0$n&n0+ gSk kP R @p` / HxNPO0+ g.Sk kP R @-H/ N>XOP n`/ / N$XOP/NRPO0+ gSk kP R @p.` / /. N"PO/ Hx/.Nr / Hx/.V@g k f `&S fpL N^NuNVH0E&n/+ NXO'@ /+(NXO'@(/+,NXO'@,/+0NXO'@0/+4NXO'@4/+8NXO'@8L N^NuNVH0*. E.( ` G('V@gx E$h8`j2$R f E&h4`. k$"hfJ,g+3V@g k,h2&S fB E$h8`*3V@g R%@4$R fJg/NvXO(/N@XO, E/($B/N -@ D!F$ DB( DHx/N!_, DB0 F!G F!n FBh, F"D!i,2 E&h4`D k$"hf4J,g. k,(3V@g'F4 k,Hx/(4N'_8B,&S f E$h8`6*3V@g&/N.` / /. NPO/ Hx/.NH / Hx/.N6 L N^NuNVH0&nE 0+ gSk kP R @p ` / Hx NPO0+ gSk kP R @p ` / Hx NPO/ Hx/.N 0+ gSk kP R @p.` / /. NPO/ Hx/.N| 0+ gSk kP R @p.` / /.NPO/ Hx/.N< L N^NuNVH0$n &n0+ gSk kP R @p ` / Hx NPO0+ g.Sk kP R @-H/ N:XOT n`/ / N XOT/NNPO/ / N0POL N^NuNVH0$n&J`Rf L N^NuNVH0&n$n  H//.N(&S fL N^NuNVH0&n$n `\ k"h fJ+OV@f+OV@g. k +Ш./ k"h0)*H/Hk /.N&S fL N^NuNVH0$n&n`k2&S f`> j$"h ) f*J,g$ j,J,g j,"h,i2` j,h2$R fB&n`&+3V@g R'@4Hk/.NPO&S fL N^NuNVH0&n /+,NVXO$@J0g"/+0/.N PO/+,/ /.Nl ` /+,/ NPO L N^NuNVH&n/. HxN..`* KRpN KR KRB KRB KRB KRBSJfLN^NuNVH0$n&n B`V +, -@c'@0Hgh +-@ o-|Jkf/*B0+H/N~ 7@Jkf Hn/.Hj 0+H/N7@R$j/ N6XOJf ft/ N XO./ NXO L N^NuNVH0$nYJS(g yS(&h S(o#S(` S(l o #S(&k` yS(!J%K&yS( Гf k ѓ k'h`&k Гf k ѓ k'h`#S(` #S(%JL N^NuNVN^NuNV/ &n/. / NPOJkgp`6 k < C &0+Hg / NXO`/ NXOp&_N^NuNVH0$n ..&n(Jg^Jk g20+ f FJPOJg/ NXO/ N.(NXOL N^NuNVH0$n &nHxsHyPNPO.`$ g k('V@fJg'J&S fL N^NuN` / / NPOL N^NuNVH0$n &n0+ gSk kP R @p` / HxN PO0+ g.Sk kP R @-H/ NVXOP n`/ / NH0;N$$$$$$$$$*6666**$$ ` + ሀ$pL N^NuNVH0G$n'n'n 'J/ Hx!N|PO.Jg `P . SkF n>H0;N$$$$$$$$$*6666**$$ ` + ሀ$pL N^NuNVH0$nG'n'J'n 'n 'n/ Hx#NPOL N^NuNVH0G$n 'n/ Hx4NPO.Jg `$ pL N^NuNV/ G'n'n 'n / Hx5NtPOH/N 5@Jjf Hn/.Hk 0*H/N5@Sdb *-@ c-|Jjf/B0*H/N\ 5@Jjf Hn/.Hk 0*H/Nf5@`HxHk NPO'GS/ NXOL N^Nu"/g@ o/4|gSH4H@04<A` Qd`QNu$/ gL o"o02 |f|g `&|g SrB`"Qd$`QdNu$/ g o"o`QNu"/g8 o4|gS4<A` Qd`QNuNV/ &nJkg>0+HgBB0+H/HxN0+H2   NVpH0N,.&n B/ HyNPO.Jg ËҀË``po`HnHx S/3N JftpflS"/3HntNPO$@ */g *^gHy"/ NPO$@B`, /3Np./ NPOHnt /3NPORn`pf/+/NjPO*`` `"Hy$HxN |POHyVHxN lPOpL N^NuNVH0&n$K KRg /g ^f$K` L N^NuNVH0$n G,.BB/ /Nn.JgB//HxN ~`HnHx/N Jg.HxdHyNRPOJfB/HxHxN N@UHHNu @B @"D @ @  $@ @B@@ N BB/Hx/N/ Hx/N BHx/Hx/N/ Hx/N BHx/Hx/N/ Hx/N` BHx/Hx/NHnHx /N: HnBBHx /NHnHx /N HnBBHx /NHnHx /N HnBBHx /N/ Hx/N /Hx/N /.HxBN pL N^NuNVN^NuHop0//NP6N@FNuNVH0| n $p" g JR -fgR -f`J*WDHH* JRHH.JgtpA_Dg rZ\DJg м ` .&n`Jf`J\HHfJg`6J+fp'@1.9 (12/23/86)R UDATAIDATACODEHook for: %8.8s not found Cannot find psect in module %8.8s @(#)maknew.c 1.9 (12/23/86)RConvobj Map of File %s Name Username Module Psect Offset %8.8s %8.8s %8.8s %8.8s %08.8lx @(#)map.c 1.9 (12/23/86)S  IAddress overflow at %08.8lx in Module %8.8s Section %8.8s @(#)wrtfil.c 1.9 (12/23/86)  &_N^NuNVH0$n G'n'R'n 'n/ HxPN:PO.Jg `$pL N^NuNV-nHnHxFNPON^NuH $oL /N@QHUHHLNu /"/N@UHHNu"_" _N@UHH//N"/ / o "oN@UHHNu  Ddftv/Usage: Copy [-dftv] source-fg HxNvXO0+gp`p&_N^NuNVH0$n G'n'n'n / HxNRPO.Jg `$pL N^NuNVH0$n G'n'n'n / Hx N PO.Jg `$pL N^NuNV-nHnHx NPON^NuNV/ G'n'n 'n / HxNPO&_N^NuNVH0$n G'n'J'n / HxNxPO. n L N^NuNVH0$n G'n'J'n / HxN8PO. n L N^NuNVH0G$n'n'n 'J/ Hx!NPO.Jg `P . SkF n>H0;N$$$$$$$$$*6666**$$ ` + ሀ$~`HxtHyN$POJgDHnHx /N HnHx / N JfHxHnHnN Jn`:BHxtHyNPOJVDfHxfHyNPOJVDJgp`pA/Hn/ N .JgB/ /HxN ~`/./NPOJg/HyHxN ~`BHxHnBN .JgBB/HxN ~`l/././N .Jg`H0;N$$$$$$$$$*6666**$$ ` + ሀ$pL N^NuNVH0G$n'n'n 'J/ Hx!NPO.Jg `P . SkF n>H0;N$$$$$$$$$*6666**$$ ` + ሀ$pL N^NuNVH0$nG'n'J'n 'n 'n/ Hx"NPPOL N^NuNVH0$nG'n'J'n 'n 'n/ Hx#NPOL N^NuNVH0&n $n-J-KHnHx$NPOL N^NuNVH0G$n 'n/ Hx4NPO.Jg `$ pL N^NuNV/ G'n'n 'n / Hx  I0< / o "oN@UHHNuD  @  H  @ DcUsage: Crc [-c number] file [file ...] %7l,d %s @(#)crc.c 1.2 (1/10/87)1Q68010 XPU 151 Crc source version 1.2 Copyright (c) 1986 Cromemco, Inc. /I 4N.Jf(&J .A*`/HH/NPO,Rn`pfBJf n L N^NuNVHB`2/. /NPO(B`//N|PO f`R mR m//.N ,PO*Jg `//.N PO*Jg `pLN^NuNVN^NuHop0//NP6N@FNuAp// / @00Nu#2F$We6tHZl~3"VG,ud>ɍ@ۮRdv!0g&vD4UJÎXn|1 wf.TE<ˬBُPftBSap '26L^׈hzRC q`(7&:DV`rcr@Q%"40N\թjxsbPA5$* // NtPO&@XJgHyF/ N^PO&@```BHy6NXO.BB/HxN L N^NuNVN^NuHop0//NP6N@FNuNVH0&n$n JRgR` L N^NuNVH0&nE/ Hx0NTPO.Jg `j jjpL N^NuNV/ &n-KHnHxIN PO&_N^NuH $oL /N@QHUHHLNu /"/N@UHHNu"_" _N@UHH//N"/ / o "oN@UHHNu@  (HbjrzToday is %lc%lc. H0$n &nBBBB  g  g  g  fR` +fR` -fp-@RB A\Dg Z_DJgHHм `HH.p0nr9m0`panrfm Wv``Hx /N П, Ї(RR`Jfp`P A\Dg Z_DJgHHм `HHrhf,R`Jgp` .g"D`"$ L N^NuNVH0&n$n JRgR` L N^NuNVH0$n G'n'n'n / Hx N2PO.Jg `$pL N^NuNV-nHnHx NPON^NuNVH0$n G'n'J'n / HxNPO. n L N^NuNVH0G$n2@  NVpH0N $&n EB/ Hy N PO-@Jg ËҀË``NHxsHy N rPO#0JfTBBHn|Hy N .Jg`rHntHx/ /.|N^.Jfg / NnXO`pg`>`Jg KX/NPXO`Hy HxNPO `,Hy *HxNPOp`BHy /HxNpL N^NuNVtH0/.HnNPOHnHy ZHxN Hx 90gr`p"/Hy0HnN .Jg`N$&@Jf`HxHy hHkN D Jg`|Bp0+ Hx /NN PO$@Jf`|p0+ / /N4POp0+ ./bin/crc.bin 7442 77777 77777 6751 4007600436 6574 0./bin/day.bin 7442 77777 77777 2425 4007600540 6570 08FTbp,ӥ>@+R:Nd_mv|ҭ$6 H;*Z^Ol}l~ .<ѵ)B8 Pof~Lt]&н49(J Xnn\M| ׅ(:JD[iVx `/r>֍ 2ZKLyh^ h?.zՕ*8kFzHTY-b<pԝ"0{jNXI\=,jxNVH0| n $p" g JR -fgR -f`J*WDHH* JRHH.JgtpA_Dg rZ\DJg м ` .&n`Jf`J\HHfJg`6J+fp'@`Jg n R'pJf` `~`< `pL N^NuNVH0G @(#)day.c 1.2 (12/23/86)SUndayMondayTUesdayWednesdayTHursdayFridaySAturdaysh-c,1Q68010 XPU 151 Day source 1.2 Copyright (c) 1986 Cromemco, Inc. I  'n'n 'J/ Hx NPO.Jg `P . SkF n>H0;N$$$$$$$$$*6666**$$ ` + ሀ$pL N^NuH0/2/ AH@B@2/Ё/@L.Nu//lD//lDa:Jo lDJolD/_.Nu//lD//lDaJo lD/_.Nua.Nua /o.NuJof&/p0/?@0/?@H@?@ NuH$/r2/0/R@eL?A2/?A"/ /2/2/HABAdS@ԯ/@/BLNu/A2/`H $oL /N@QHUHHLNu /"/N@UHHNu"_" _N@UHH//N"// /NPOp0+ Hx /Nf/ NPO/90N XO `vHy pHxNPO/90N tXOp`VHy HxNPO/90N TXOp`6Hy HxNdPO/90N 4XOp`BHn/HxNZpL N^NuNV/ G0HnHx/N pgr `8HxB/N HnHxHy0/N Jgp`A0 &_N^NuNV H0BA&"np3@"n3@~"nG `/Hn NtPO,JgJkg F0+h gS` F7h S Fp(7@ Fp0(gS Fp(f`PS Fp(rg`4SA/Hy2 //NHx Hn20 NVH0N&n E / HyNPO-@Jg ËҀË``ZJg / /9NPOJg Jm o`2Jf`,B `A A\Dg Z_DJgHHм `HH/Hy.HxN `Hy2HxNPOpL N^NuNVH0B` A&p$n`RRg` A\Dg Z_DJgHHм `HH-@ A\Dg Z_DJgHHм `HH".gJfJg am zn ` RpndpL N^NuNVHnNXOp.SN^NuNVH0$nG!E  &# ! /./ NPOHy B/ N .JgB/ /HxN~`8/ Sp0(// y! N Jf Sp(rfN. L N^NuNVH0E!G `RfBBHnHy N.JfHy!0Hx / /.N.Jfp !0f2*H¼gB*/ +/WDf +^WDJg `Hy/ NPO/NPOHy BHy N .Jg`L/9!p0*/Hy  y! N Jf$ y!p(rf a.Jg``"pfB/.NXOBJgpgBHy /HxN~ L N^NuNVN^NuNV./bin/dcheck.bin 7442 77777 77777 13472 4007600652 7264 0  /Nd (r f0.Hf`p0.g p0. cHn/Hy HxN z`rRk np0."ЁEp0* dRj`R@p0gRp0*gR5G`p0*f5G`p0*gR`0Jg/Hy HxN  z` F0("kgS`/Hy HxN zR o> L N^NuNVH0E B~ nG `B2p0 g>p0f JkfJkg&J0g p#2`/Hy!"HxN |p0g$p0+f&J0g p#2`/Hy!JHxN |p0gp0g&J0g p#2`/Hyr block Inode %6ld, cannot read inode Inode %6ld, error reading directory Inode %6ld, file "%s" has bad inode Inode %6lu, bad inode number in inode Inode %6lu, allocated inode with 0 links Inode %6lu, bad directory entry count Inode %6lu, directory with more than one parent Inode %6lu, directory with wrong parent Inode %6lu, bad link count %5lu, should be %5lu Inode %6lu, more than 255 links Inode %6lu, unallocated inode with %3lu links Inode %6ld, cannot write inode Inode %6ld, cann$N^NuNVH0| n $p" g JR -fgR -f`J*WDHH* JRHH.JgtpA_Dg rZ\DJg м ` .&n`Jf`J\HHfJg`6J+fp'@`Jg n R'pJf` `~`< `pL N^NuNV/ &nHH g\` +&_N^NuNVH0$n&nB` B'"<ЁRpn'n ('n,B0 k('h4L N^NuNVH0(.&n +04cp` Ы04c +40(B`j/+0HxNX/ NjPO$@Jfp`R/+0HxN@* <"o <` ,/ Ѕ//. N2A\GqNVH0NAl$n GFpo`dBNDXO.JgBBHxN `@BBHypHHj/*ND .JgB/*/HxN` HypL/9pHHxND( .JgBB/HxN`BHxHypHyQ6NA.JgBHyQ6/HxN`BHxHypHyQ@N@.JgBHyQ@/HxN`hNNhN8Nx,lHyQJHxNEPOJoHnHnHypHBNBx.JgBB/HxN`../9pN@XO `HyQNHxNEJPOpL N^NuNVH0EHypN?XOJgp`JHyQbHxNEPOHxP**$$ ` + ሀ$pL N^NuNVH0$n G'n'R'n 'n/ HxPN^PO.Jg `$pL N^NuNVHnHxRN2PON^NuH0/2/ AH@B@2/Ё/@L.Nu//lD//lDa:Jo lDJolD/_.Nu//lD//lDaJo lD/_.Nua.Nua /o.NuJof&/p0/?@0/?@H@?@ NuH$/r2/0/R@eL?A2/?A"/ /2/2/HABAdS@ԯ/@/BLNu/A2/`H $oL /N@QHUHHLNu /"/N@UHHNu"_" _N@UHH/`h SJg^ r³gr `NB`" "ЁAp "$0f`Rmھf R"ЁAp "!`pL N^NuNVH0,.$n Gppl"+`p".Jo#p SJgNRJfN.p`pLN^NuNVH0GEpLJgp`p0*FrfN`N Hx/*BHnN p0. ag"p0. Ngp0. N@fV/*B/9pN POЪB&Hx/HkN!tHxN |p0g/Hy!HxN |p0g&J0g p#2`/Hy!HxN |0+kg6J0g p#2`$p0+/p0+//Hy!HxN|p0@g/Hy"*HxN |`"Jkgp0+//Hy"LHxN|J2g/ /N$POJg|R o: L N^NuNVxH0,.$n B/Hn|NPO&@Jgx7Fp0g@p0*f+`0+p0g7j jp0g7j"/Hn|NPOJf/Hy"|HxN B ~`/Hy"HxN * ~ L N^NuNV/ &n/. NXOJf&HnHx/ /90Not read inode @(#)dcheck.c 1.5 (12/23/86)(1Q68010 XPU 151 Dcheck source 1.5 Copyright (c) 1986 Cromemco, Inc. r/etc/passwd/dev/####sh-csh-cI0  ݮ ݫ0ކn L N^NuNVH0,. (.Bpc-F`L e$ R/HxN-/HxN,S` R- "Ҽ- D"h(E@ D "Ҁ&A "6*2fHx/+NPOB`g/+/ D"h,NPOJgp`&Jf +` $kSQ`L N^NuNVH0&n $n .SJggrt `RR`pL N^NuNVH0&n$n JRgR` L N^NuNVB/.HnBNJgp` .N^Nu"/g@ o/4|gSH4H@04<A` Qd`QNu$/ gL o"o02 |f|g `&|g SrB/ NLPO  oHnHn/ N& &@Jfp` Hn/.NPOL N^NuNVH0,.Gp@&N S %f*BE FRN Sg F R! F B`LNZ$@JgB#pDB`& F HpNXOJf`N S ,fRRpnN Sg n L N^NuNVH0GQf`"//9p@NVPO$@Jg #p@ +`PAQ npL N^NuNVJgp`N XpN^NuNVH0,.GEp plr `0p09prfN`pf n gp`NNNPp09prfNdpf, n &Hx/HkNr Hx/HyPN B`@Hx "Ё/2Hr/N"/ / o "oN@UHHNu @@  @@ @@@@ :"s/etc/mtabEnd of dcheck Usage: Dcheck [-s] [device device ... device] Device: %s cromixNot a Cromix device Insufficient memory Cannot read supe @ Hx/HyPN h N Hx/HkN R `N N p0*FrfUBNLpL N^NuNVH0Gp@Epplr `Jo n $Hx/HnN p.//HyR HxN>XHxPHnN`POJgSgSgSfg R`|p`|S`t S 'g S "f R @`BJg* Sg SgHx R/ R/N Z `R`*HnNXOJgnHx R/HnN * `.L N^NuNVH0EGpplr `Jo n &pgp`~Hx// N p0//HyRHxN=HHxPHnNPPOJgSgSgSf4g T`.p`,U`&HnNXOJgJf gp` м&_N^NuNV/ &n/. NHXOJf&HnHx/ /90NJf gp` м&_N^NuNV/ G0Sp0+ bp`$p0+".Ё/B/90N" &_N^NuNVH&n ./B/90N .Jg `2HnHx/ /90N.Jg ` fp`pLN^NuNVN^NuHop0//NP6N@FNuNVH0&n E#f`RRg4 A\Dg Z_DJgHHм `HHHHgg . ` /Hy#f/.NnPO/NfPO .L N^NuNVN^NuNVB/. HnHxN./bin/ddt.bin 7442 77777 77777 66144 4007601142 6615 0`"Qd$`QdNu$/ g o"o`QNu"/g8 o4|gS4<A` Qd`QNuNVH0$n G'n'n'n / Hx NPO.Jg `$pL N^NuNV-nHnHx NPON^NuNV/ G'n'n 'n / HxNPO&_N^NuNVH0$n G'n'J'n / HxNtPO. n L N^NuNVH0$n G'n'J'n / HxN4PO. n L N^NuNVH0G$n'n'n 'J/ Hx!NPO.Jg `P . SkF n>H0;N$$$$$$$$$*6666N< Hx "Ё/2HyPNX RpN,Jf6/HyQHxNA /HxNrPOђHyQHxNArPO`pL N^NuNVH0,.&n Ep+p08r fp0+/NhXO> /HnNPO// Hyg"/9qhN(/.Hx/ p0/N LpLpe ",3`Zpe "Q,3 `Hpf r2+@,`8pf,+B`,pe"Ap,0`pf,9p`B/ AP/0HyS"HxN8HxPHnNPO*pfr/ NXOJgfpe "'`Tpe "Q' `Bpf7j@`4pf'RB`(pe"Ap!` pf#pB L N^NuNVH0&nEp@/. / NPO$N. RJfp` R .fp` R -fp`pL N^NuNVH0GHx/9p/ N p0+/p0+ /p0+ /p0+/p0+/p0+/p0+/p0//9pHyS2HxN7(,$K,`Hp NV/ &n / Hye6/9qhN( p&_N^NuNVH0&n$n p0// Hye /.Hx/ p0/N".p0r /Hyet$`$#p@pL N^NuNVH0$nNJB`$ APp/0/9p@NPO&@Jg`Rpn fp` #p@$pL N^NuNV/ Gp@ S  g S  g S  g S  fR`&_N^NuNVHGq\HySv/ N-PO~`pfp xA  SJl LN^NuNVHypL/9pHHxN/ JgNN^NuNVHypL/9pHHxN/ JgNbN^NuNVH0&n $n/./ / /9pHHxN/|JgN,L N^NuNVH0&n$n /./ / /9pHHxN/@JgNL N^NuNV/HypHyq N@PO/9pHHxN/PO.Hyq HypNPOJgN.N^/p0+// Hyf&/9qhN"pL N^NuNVH0&n$n p0/p0+/p0r // Hyf>/9qhN"pL N^NuNVH0&n$n p0+/p0+// HyfV/9qhN"Lp0+/N.p0+/N.p0+/p0+/Hyff/9qhN!pL N^NuNVH0&n$n V @p// Hyfz/9qhN!/.Hx/ p0/NL N^NuNVH0&n$n p0+/p0+// Hyf/9qhN!\/.Hx/ p0/N@L N^NuNVH0&n$n p0+/N./ Hyf/9qhN   N^NuNVH0&n$n / Hyg,/9qhN /.Hx/ p0/N .p0+/HnNPO/Hyg2/9qhN L N^NuNVH0&n$n p0// Hyg6/9qhNdpL N^NuNVH0&n$n p0// HygD/9qhN(pL N^NuNVH0&n$n p0+/N.p0+/N./ HygR/9qhNpL N^NuNVH0&n$n p0+/Nz.p0+/N(./ Hyg^/9qhNpL N^NuNVH0&n$n p0r /p0// Hygj/9qhNDpL N^NuNVH0&n$n p0+/p0r /p0f(Jg Hyk/NPO/Nt.Hyk/N z g fHyk/NPOz UgSf^g0Jg Hyk/NPO D Rr20/Hyk/N `,Jg Hyk/NPO "Ҁ A/Hyk/N THyk/NPO` .k nH0;N .N D Rr20/Hyk/N `p "Ҁ A/Hyk/N T`P йqd-@ D"R40H&"Ү/"/Hyk/N` йqd-@ D"Rt40,"¼f:"¼HH&/N. Ю/ /Hyk/N`Hyk/NPOB g Hyk/NPO Up0+r k nH0;Nr|^.p0+/p0+r /Hxp0+?AiB/0NNPO/Hyjj/9qhNz~`6/ Hyj|/9qhN^ ~`p0+r ,pfJt4+ļ/t4+ļ/HxHyi2NPO/Hyj/9qhN~`Ajbp0h/p0+?C/1NPO/Hyj/9qhN Ajbp0h/Hx/ p0/N.p0+/Hyj/9qhNn `,p0+r ,p0+/Ajbp0h/Hyh4NPO/Hyj/9qhNAjbp0 AlJ"0 .N^NuNVH<. :BF~` H< @ H:SJf LN^NuNVH0>.$nHxD // NX &@ g g KRp/HxA // N &@B L N^NuNVH<.&nxBFJFg gh* g R H<`Jf KRp/ KR KR м0 Rl KRp- KR KR"Ҽ/B`R H<`x LN^NuNVN^NuHop0//NP6N@FNu"_ WHpN o /LNNVH0&n$n JRgR` L N^NuNVH0$n G'nV/0/ N 8PO/Hyk/9qhN /.Hx/ p0/NL N^NuNVH0&n$n .UgSfg T @0H.|` T @.| 9qdTЇ/p0AV/0/ NPO/Hyk/9qhNP L N^NuNV/ &n . AU/0/ HyqlN PO/N POAql &_N^NuNVH. B~`   SJf LN^NuNVH. Gq|xBJg gt, g R `Jf KRp/ KRpF KRrP KR$Լ0$Rl" KRt- KR KR KR м/B`R `lBAq| L"/ /2/2/HABAdS@ԯ/@/BLNu/A2/`NVN^NuBH />A/NFXXLDXNuaaaaaaaaNV/.HynHxNl HxNXON^NuNV-nHnHxFNPON^NuH $oL /N@QHUHHLNu /"/N@UHHNu"_" _N@UHH//N"/ / o "oN@UHHNu   B B @H@@@  @// Hyg|/9qhNpL N^NuNVH0&n$n p0+/p0r /p0// Hyg/9qhNpL N^NuNVH0&n$n p0/p0gp0r `p// Hyg/9qhN@pL N^NuNVH0&n$n p0/p0r // Hyg/9qhNpL N^NuNVH0&n$n p0/p0r // Hyg/9qhNpL N^NuNVH0&n$n 9qdT2+HЁ/p0// Hyg/9qhNZpL N^NuNVH0&nEqh/. Hyg/N* p0 f"p0+r UgSfFg$ D R20H&/Hyk/N z` "Ҁ A&T/Hyk/N z f&Jg Hyk/NPO Ю/Hyk/N gHyk/NPOz @f(Jg Hyk/NPO/N.Hyk/N z g fHyk/NPOz UgSf^g0Jg Hyl/NPO D Rr20/Hyl/N `,Jg Hyl/NPO "Ҁ A/Hyl /N THyl/NPO`Hyl/NPO .Sk nH0;Nt88 D Rr20¼/Hyl/N ` D Rr20/Hyl/N D Rr20/Hyl h/Hx/ p0/N.pf8r2+¼-At@Įg/.Hyj/9qhN pf$r2+¼/Hyj/9qhN `JHxHyi:N6PO/Hyj/9qhNb BHx/ p0/NH.p0+r AjB/0Hyj/9qhN `p0+r AjB/0HxHyi:NPO/Hyj/9qhNBHx/ p0/N.`zHxHyi:NfPO/Hyj/9qhN BHx/ p0/Nx.p0+g&p0+/Hyj/9qhNH `Hkp0+gp./N XO@p./NN.Hy'n'n / Hx NPO.Jg `$pL N^NuNV-nHnHx NPON^NuNVH0G$n'n'n / HxNXPO.Jg `$ pL N^NuNVH0$nG'n'n 'n 'n/ HxN PO.Jg `$ pL N^NuNVH0$n G'n'J'n / HxNPO. n L N^NuNVH0G$n'n'n / Hx(NPO.Jg `$ pL N^NuNVH0G..$n Joplp"`p'GA f SAnh"0` "'A/ Hx@NPO,Jg `2 n-H SAnh"+fC ` + n pL N^NuNVH0N^NuNVH0(. ..GqhEp0. -@r2. ¼kB n8I2;N(>Tjx/.Hyk*/N `/.Hyk0/N `/.Hyk6/N `/.Hyk>/N `/.HykF/N `/. D Rr20/HykN/N` D Rr20, f(/Nt./. /Hyk\/N`Hykl/NPOB g Hykn/NPO UgSfBg" D Rr20/Hykp/N z` "Ҁ A/Hykv/N Tz f$Jg Hyk|/NPO/.Hyk~/N z gHyk/NPOz @@    @ !@@ @@BH @$A @@@   B $$  @@@@@ H@$@$@H @@ $@ $@ @/Hyg/N /.Hx/ p0/N .p0+g"p0+/Hyg/N ` p0+/Hyh/N p0+ g p0+/Hyh /N` `0p0+gp0+`p /Hyh/N. p0g4p0 g"p0+r /Hyh/N L N^NuNVH0&n$n / Hyh/9qhN /.Hx/ p0/N.p0+r t4+ļf$p0+/Hyh"/9qhNb `4p0+r /p0+/Hyh(/9qhN, L N^NuNVH0&n,.E/N D Rr20/Hyl&/N D Rr20/Hyl,/N D Rr20/Hyl2/N D Rr20/Hyl8/N L N^NuNVHGl>>. gpA`pD r 0@ gpL`pW@ r gSgSgSf0g"B+`(p*@r2A`p*@r4A` p*@r8A LN^NuNVH0$nGq` xf/. / N^PO&@` KRRfBAq L N^NuNV/ GlFp0. gpA`pDp0. r 0@ &_N^NuNV/>. G rdG rd~j/9qhN `HxHyi:NPO/Hyj/9qhN p0+g&p0+/Hyj/9qhN `Hkp0+gp./NzXO@p./N.Hyj/9qhNX BHx/ p0/N>. L N^NuNVH0&n$n p0+AV/0/ N @PO/Hyj/9qhN .UgSf>g p0+/Hyj/9qhN p`/+Hyk/9qhN p`pL N^NuNVH0&n$n 9qdX2+HЁ/p0/p0+AV/0/ N PO/Hyk/9qhN8pL N^NuNVH0&n$n p0+A$n G'n'R / HxENPO.Jg `$ n  n pL N^NuNVH0$nG'J'n'n/ HxHN\PO.Jg ` n pL N^NuNVH0$n G'n'J'n'n/ HxKNPO.Jg ` n pL N^NuNVH0$nG'n'n 'J'n'n / HxNNPOL N^NuH0/2/ AH@B@2/Ё/@L.Nu//lD//lDa:Jo lDJolD/_.Nu//lD//lDaJo lD/_.Nua.Nua /o.NuJof&/p0/?@0/?@H@?@ NuH$/r2/0/R@eL?A2/?A  @ $@H@ @@ H @ $H $  $@H $$@ @ @@@ @ @ @@@ @  @ PSSSSSSSSSSSSSSSSWNpWNpW~@UP!VP@!VP!VQ!X(Q@!X(Q!X(PW(P XLP XLPTXLPX>PU`#.V`#.V`#.Va#.Va#.Va#.V`V`V`Vp+XWpUW@WWW2!X"JX$W@+WH+W@$Wra0ra1ra2ra3ra4ra5ra6ra7srpcv0v1v2v3v4v5v6v7vbbxdmexsbslswbcdghilstRunningInitialBreakTraceSignalExitsigabortsigusersigkillsigtermsigalarmsigpipesighangup1Q68010 XPU 151 Ddt source 1.3 Copyright (c) 1986 Cromemco, Inc. ln?????llllllllllllllllllllllllllllllllmmmm mWn|4WnH5BWT@5Wj6WP6WPpWd@pWZUXhZ[[$[@^l___`aRa`bbcdmmmmmmmmmmmmmmmm%-12s%-12sD%ld%-12sA%ld%-12s%-12s,D%ld%-12sD%ld,%-12s,A%ld%-12s,%-12s#%02lx,%04lx,%08lx,%-12s#%04lx,SR%-12s#%02lx,SR%-12s#%ld,%-12sD%ld,D%ld%-12s-(A%ld),-(A%ld)%-12sD%ld,D%ld%-12s(A%ld)+,(A%ld)+%-12s%08lx%-12s(%04lx,A%ld),D%ld%V pW8 @ pW8 pW8 %>W pW @ pW pW %>WW@WW%>WUW @W W0@W0WIWFAW AW AzWAU@pW@@pW@pW@&bWBpWB@pWBpWB&WDpWD@pWDpWD'JWFpWFUmmnnnnn$n.%-12sFP%ld,FP%ld%-12s%-12s#%02lx,FP%ld%-12s,FP%ld%-12sFP%ld,{#%ld}{D%ld}%-12s,%s%-12s%s,%-12s,D%ld,%s%-12sD%ld,%s,%-12s#%04lx#%08lx%-12sD%ld,%08lx%-12s%-12s%08lxD%ldA%ld(A%ld)(A%ld)+-(A%ld)(%04lx,A%ld)(%02lx,A%ld,%s)([%04lx%08lx,A%ld],%s],%04lx,%08lx)(%04lx).W(%08lx).L(%04lx,PC:%08lx)(%02lx,PC:%08lx,%s)([%04lx%08lx,PC:%08lx],%s],%04lx,%08lx)#%02lx%04lx%04lx%04lx%04lx%04lx%04lxRSSSSTTTT TTTTT T$T(T,T0T4T8T<T@TDTHTLTPTTTXT\T`TdThTlTpTtTxT|TTTNE /dev/null/dev/tty? Usage: Ddt command -> TDTT (T(T T 4TxT,TTTT @TT Tt%08lx %l,d. %08lx Breakpoint at %08lx %08lx %02lx %08lx %04lx %08lx %08lx she+Xb+Xb$WW,UX4@X4X4zX!X."JX.$X4@!X.H"JX.@$X4!X."JX.$X4zXUUW$@W$W$zW"W$W>H"W@$W>"W$W>zWUV@VVWmmmm m$m(m,m.m2m6m:m>mBmFmJmNmTmXm\m`mdmhmlmpmtmxm|mmmmxABCDADDAADDIADDQADDXADDANDIANDBKPTBRABSRBxCALLMCAS2CASCHKCLRCMPACMPICMPMCMPDBxDIVSDIVUEORIEOREXGEXTBEXTFBxFDBxFRESTOREFSAVEFSxFTRAPxILLEGALJMPJSRJSYSLEALINKMOVEAMOVECMOVEMMOVEPMOVEQMOVESMOVEMULSMULUNBCDNEGXNEGNOPNOTORIORPACKPEARESETRTDRTERTMRTRRTSSBCDSTOPSUBASUBISUBQSUBXSUBSWAPS-12sD%ld,(%04lx,A%ld)%-12sD%ld:D%ld,D%ld:D%ld,(%s):(%s)%-12s#%02lx,%-12sD%ld,D%ld,%-12s%s,%-12s,%s%-12sSR,%-12sCCR,%-12s,SR%-12s,CCR%-12sA%ld,#%04lx%08lx%-12s#%ld%-12s#%ld%-12s#%04lx%-12s#%04lx%08lx%-12s%s,%-12s,%s%-12sA%ld,USP%-12sUSP,A%ld%-12s%s,%s%-12s%s,%s%-12s#%02lx,D%ld%-12sD%lx,D%lx,#%04lx%-12s-(A%lx),-(A%lx),#%04lx%-12s#%ld,D%ld%-12sA%ld,A%ld%-12sD%ld,A%ld%-12sD%ld,%08lx%-12sD%ld,{D%ld:{#%lx:D%ld}#%lx},D%ld%-12s,D%ld,D%ld:D%ldFMOVEFINT@pWFpWF&WH'WHpWH@X8HH(,VH@pWHWLH)VWHWLH)VWJpXXJ@pXXJpXXJWvJpXBLVL@VL)WL)WN@(WN@(hXRNP'WNX4X\N`*HWNh*WNpWNqWNr(XNsXNt(WNuX NvXFNwXNz*WN{+ n.S*sRnn>nBnFnLnPnTnZn^nb@(#)dis.c 1.2 (11/12/86).B.W.L.S.D.X.PTSTCHGCLRSETTFHILSCCCSNEEQVCVSPLMIGELTGTLEFEQOGTOGEOLTOLEOGLORUNUEQUGTUGEULTULENETSFSEQGTGELTLEGLGLENGLENGLNLENLTNGENGTSNESTASRASLLSRLSLROXRROXLRORROLBFTSTBFEXTUBFCHGBFEXTSBFCLRBFFFOBFSETBFINSCMP2CHK2MULUMULSDIVUDIVSDIVULDIVSLFPIARFPSRFPSR/FPIARFPCRFPCR/FPIARFPCR/FPSRFPCR/FPSR/FPIARSll-c 0 1 2 3 4 5 6 7 TTTTTTTTTTTUUUDn = %08lx An = %08lx %-8sSR=%04lx %s PC=%08lx %-10s Term stat = %04lx %-5s = %08lx %06lx %04lx %04lx %04lx %04lx %04lx %04lx %04lx %04lx %lc XNZVCFirst = %06lx Next = %06lx @(#)ddt.c 1.3 (1/27/87)D0D1D2D3D4D5D6D7A0A1A2A3A4A5A6A7SRPCV0V1V2V3V4V5V6V7VBrd0rd1rd2rd3rd4rd5rd6rd7!V"JV$V@"WBH,WB@$V,WB$VWUV@VЀVzV!V"JV$V@!VH"JV@$Vр!Vш"JVр$VzVU,V V@,V`V,VVV VU/Vz4Wn{4xTASTRAPVTRAPxTRAPTSTUNLKUNPK#WH#W#W#W4VU<!\W|! W<!\V|! V <!\W8 |! W8 $PW $PW$PW pW@ pW pWhV pV@ pV pVhV pX"@ pX" pX"hV pV@ pV pVX4X$V|FSINHFINTRZFSQRTFLOGNP1FETOXM1FTANHFATANFASINFATANHFSINFTANFETOXFTWOTOXFENTOXFLOGNFLOG10FLOG2FABSFCOSHFNEGFACOSFCOSFGETEXPFGETMANFDIVFMODFADDFMULFSGLDIVFREMFSCALEFSGLMULFSUBFSINCOSFCMPFTSTFMOVECRFMOVEMh4h:h@hFhNUhTUh\hdhjUhphvh~hhhhUhhhUhhhUhhhhhhhhhiiiiUUUUUUUiiiiiiiii&Ui,UUUU CFDCFCACRUSPVBRCAARMSPISP???FFFHFJFLFNFPFRFTUnexpected signal number %ld UUUUUUTUUUUUUUUUUUUUUUUPD$H"D$H"D$H"D$H"D$H"D$H"D$H"D$H"D$H"D$H"D$H"D$H"D$H"D$H"D$H"D$H"D$H"D$H"D$H"D$H"D$H"D$H"D$H"D$H"D$H"D$H"D$H"D$H"UUUUUUUU@UUU!$*);^-/ |,%_>? `:#@'=" abcdefghi jklmnopqr ~stuvwxyz [ ] {ABCDEFGHI < + }JKLMNOPQR \ STUVWXYZ % 0123456789: 7-./% <=2&?'"5@Z{[lP}M]\Nk`Kaz^L~no|_myjС%(FL|.^#V#bkW%%+}<rw= 8Dp0!v Missing filename 8p0 87qp8 !B8+q pPYFs r ͚8DMx(!7 I @ @@./bin/deltree.bin 7442 0 0 11324 4007601262 7151 02@x(NVH0N&n E0/ Hy NhPO.Jg ËҀË``po`HxaHy N PO#0JgHnHxBHxBN /NLXORgUfx X#0// N.POJg p#0`TJ0g/ Hy NVPOJg:/ Hy0 NPO/N.0/ NdPOJg/ N`XOJgp#0`B/HxHxNp#0J0gHnHx/.HxBN  90`"Hy :HxNPOHy bHxNPOpL N^NuNVH0$nHnHy0 NPO.JgSJm */g *^f&J`Hy p/ NPO&@ G . $$"@! @@@  @ @@  /0/ NPO&@Hy0 NXORg@Uf/ a~XO/90 G ./0N:POJgHy0 N2XOJgp#0`hB/NXO`p#0L N^NuNVH&nBJ0f/ Hy rNPOJg>/ N PXO.JgB/ /HxN r`J0g/ Hy ~HxN < Jgp`pLN^NuNVH&nHnHx/ N < .JgB/ /HxN p#0` .LN^NuNVH0G$nHnHxHxHxBN /. / HxN / BN POHy HxN POHnHx/.HxBNprASDg ptZTDJg pм `pryWDHHL N^NuNV| (12/23/86)1Q68010 XPU 151 Deltree source 1.6 Copyright (c) 1986 Cromemco, Inc. !$@(#)doname.c 1.1 (12/23/86)I0 fp` A\Dg Z_DJg HHм ` HHf`VR -g`HxN p0+/HyhHxN p0+ gp0+/HyHxN p0+ /HyHxN +HH/+HH/+HH/+HH/HyHxNp+ gp+/HyHxN p0+ gp0+/B/9#N rf `HnHx@Hn/9#Nrf `HyDHxNPOp0,p+r+//N Xp0+/N LHxN (p0+ -@B`P r26 f`B r26//N /./HyxHxN r26-ARp n //N/ Hx!NPO.Jg `P . SkF n>H0;N$$$$$$$$$*6666**$$ ` + ሀ$pL N^NuNVH0$n G'n'R'n 'n/ HxPNFPO.Jg `$pL N^NuH0/2/ AH@B@2/Ё/@L.Nu//lD//lDa:Jo lDJolD/_.Nu//lD//lDaJo lD/_.Nua.Nua /o.NuJof&/p0/?@0/?@H@?@ NuH$/r2/0/R@eL?A2/?A"/ /2/2/HABAdS@ԯ/@/BLNu/A2/`H $oL /N@QHUHNPOp`Hy|HxNPOL N^NuNVH0&nEHy/ N"POB`D 3Ax\Dg 3Zx_DJg3xHHм `3xHH2xHHg[`Rpn Z/ Z/NPOBBHy#/ N,Jg`HnHx/9#N ,Jg`HnHx/9#N ,Jg` </ .// HyHxN .UgSgSg*[fJg6HyHxNPO`JHyHxNPO`8HyHxNPO`&Hy HxNPO`HyHxNPOp` 9#`B/ /HxNpL N^NuNVN^NuHop0//NP6N@FNuNVH0GE/ NT.NXOpH0G$n/ NXO.JgBB/ HxN `h/. NXO.JgBB/. HxN `B/ N`XO.JgBB/ HxN ` / NbXO.JgBB/ HxN  L N^NuNV|N^NuHop0//NP6N@FNuNVH0EBBHn/.ND.JgB/./HxN >`/ Hx/.N pl"`p"/NXO&@Jg`JgRHn// /.N.JgBB/HxN / NXO` n -H// N@PO n ` n BB`BBHxHxN /.NXO L N^NuNVH0(. &n$K* Є/Hx N ( ÊҀÊB SJgR0*H./bin/diskinfo.bin 7400 77777 77777 12442 4007601366 7642 0 JRgR` L N^NuNVH0..E!@por` X"¼Ё".JgD&R&k* n. Pn Г&@&` R!k fBA `<$&kf м,/N&XO&@Jfp`& X/N6XO`L N^NuNVB/.HnBNJgp` .N^NuNVH0$nYJ!@g y!@&h !@o#!@` !@l o #!@&k` y!@!J%K&y!@ Гf k ѓ k'h`&k Гf k ѓ k'h`#!@` #!@%JL N^NuNVN^NuNV/ &n-KHnHxNPO&_N^NuNV/ &n-KHnHxNPO&_N^Nu/./HyHxNp0+/B/9#N rf `B` A r1Rp0+b +Sfp-@ +2fz`z`BJgB`Hn/9#NPOrf `pp. f`p., A r.1Hn/9#NPOrf ` A r.$ԁ1Hn/9#N\POrf `p., A r.1Hn/9#NPOrf ` A r.$ԁ1Rp0+b`B`rHn/9#NPOrf `Zp. f`P A r.1Hn/9#NPOrf `HLNu /"/N@UHHNu"_" _N@UHH//N"/ / o "oN@UHHNuD B  !@ D aDo you REALLY want to delete all of %s? Usage: Deltree [-a] directory-pathname [file-list] /Delete %s? %s @(#)deltree.c 1.6*/p*/p/pмl/p+/p+A/0Hy/.N L N^NuNVN^NuNVH0&n$n JRgR` L N^NuNVH0$n G'n'n'n / Hx NJPO.Jg `$pL N^NuNV/ G'n'n 'n / HxNPO&_N^NuNVH0G$n'n'n / HxNPO.Jg `$ pL N^NuNVH0$n G'n'J'n / HxNPO. n L N^NuNVH0&n E%n/ HxN^PO.Jg `pL N^NuNVH0G$n'n'n 'J/ Hx!NPO.Jg `P . SkF n>Hg>Hx/ NPO.rm`R S2gSB Ї& SJg SS C``B` E ! KRg`Rn E B L N^NuNVH0&n $nJfp`Jg KX// NPOJgp``pL N^NuNVH0&n$n .f .fRR`p` / / N POL N^NuNVH0&n$n HH.Jg g$g flgFJfp`RR`BR *f|`/ / aPOJfJf .fp`tRJf```Zg KRHH// N\PO$@Jg`:p`DpA_Dg rZ\DJg м ` HHgp`RR`4JWDHHL N^NuNVH.&nRJg ]20 <NVH0N &.E G#pgrl`pf n /(HyHxN n /(NXOrf `HxN HXOHy HxNPOHxhB/9#N  rf `NHnHxHy#/9#N \rf `&p0gFp+g>p+g6p0+g.p0 g"p+ g +Cf p0+rpdHyHxNPOp`p0r2+t+҂S/r+/N П,Hy.HxNPOp+/Hy@HxN /HyjHxN p0+/HyHxN p0+ gp0+/HyHxN p0+ /HyHxNV/ &n-KHnHxNPO&_N^NuNVH0$n G'n'n'n / Hx NPO.Jg `$pL N^NuNV-nHnHx NdPON^NuNVH0$nG'n'n 'n 'n/ HxN,PO.Jg `$ pL N^NuNVH0$n G'n'J'n / HxNPO. n L N^NuNVH0&n E%n/ HxNPO.Jg `pL N^NuNVH0G$n'n'n 'J/ Hx NlPO.Jg `P . SkF n>H0;N$$$$$$$$$*6666**$$ ` + ሀ$pL N^NuNVH0G$n'n'n 'J A r.1Hn/9#N\POrf ` A r.pHn/9#N*POrf ` A r.1Hn/9#NPOrf ` A r.1Hn/9#NPOrf `V A r.pHn/9#NPOrf `$Hn/9#N|POrf `Rp0+bBHyHxNPOHyHxNPOHyHxNPOB` A 20Htf`| A 20H/20H/20H/20H//HyTHxNR/.HxNvJfHyrHxNPO`HytHxNPORp0+bn/.HxN:JgHyzHx 0;N$$$$$$$$$*6666**$$ ` + ሀ$pL N^NuNVH0&nE/ Hx0NPO.Jg `j jjpL N^NuNVH0E&n/ Hx2NPPO.Jg `j jpL N^NuH0/2/ AH@B@2/Ё/@L.Nu//lD//lDa:Jo lDJolD/_.Nu//lD//lDaJo lD/_.Nua.Nua /o.NuJof&/p0/?@0/?@H@?@ NuH$/r2/0/R@eL?A2/?A"/ /2/2/HABAdS@ԯ/@/BLNu/A2/`H $oJm R @p ` / Hx NPOp2x/Hy / N RnSJm R @p ` / Hx N~POB`|p2xSJm8 R @-H  ]Df WDJgp.` HH n`*/  ]Df WDJgp.` HH/NPORnSJm R @p ` / Hx NPO؅օ`hpL N^NuNVN^NuHop0//NP6N@FNuNVH0$n &nA-H JRgh %f0B -fR 0fRz0`z B`"Hx /.N( JRHHП0-@ 0m 9o .fH0;N$$$$$$$$$*6666**$$ ` + ሀ$pL N^NuNVH0$n G'n'R'n 'n/ HxPNFPO.Jg `$pL N^NuH0/2/ AH@B@2/Ё/@L.Nu//lD//lDa:Jolternate tracks....... = %ld Start of write precompensation... = %ld Location of alternate tracks..... = %ld Number of sectors per track...... = %ld Bytes per sector................. = %ld Location of alternate track table = %ld Location of partition table...... = %ld Starting cylinder of disk........ = %ld Disk label....................... = %lc%lc%lc%lc Sector interleave factor......... = %ld Partition # Starting Cylinder Size (Kbytes) %5ld %ld %ld %5ld %ld %ld AltR"@p`/ R @HH/NPO` .SJo.SJm R @ `/ HH/NPO``2z .X @.B-G`R .R @f g o&. .ڐ-@"¼f: .SJo.SJm R @ `/ HH/NPO` SJg6SJm R @ R"@p`/ R @HH/NPO` .SJo.SJm R @ `/ HH/N|PO``.`,SJm R @ `/ HH/NJPO`,SJm R @ `/ HH/NPO`L N^NuNVH&nJk gP/ N6XO.0+ HgHx/+N./bin/dump.bin 7442 77777 77777 14017 4007601470 7003 0 N^NuNVH0| n $p" g JR -fgR -f`J*WDHH* JRHH.JgtpA_Dg rZ\DJg м ` .&n`Jf`J\HHfJg`6J+fp'@`Jg n R'pJf` `~`< `pL N^NuNV/ &nHH g\` +&_N^NuNVH0$n &nBBBB  g  g  g  fR` +fR` -fp-@RB A\Dg Z_DJgHHм `HH.p0nr9m0`panrfm Wv``Hx /N П, Ї(RR`Jfp`P A\Dg Z_DJgHHм `  lDJolD/_.Nu//lD//lDaJo lD/_.Nua.Nua /o.NuJof&/p0/?@0/?@H@?@ NuH$/r2/0/R@eL?A2/?A"/ /2/2/HABAdS@ԯ/@/BLNu/A2/`H $oL /N@QHUHHLNu /"/N@UHHNu"_" _N@UHH//N"/ / o "oN@UHHNu @  HD@p` .g"D`"$ L N^NuNVH0$nGp0.'@'n 'J/ HxNXO,p#ZHy^/N POHxNXOHynHxN PONBHn/NPO`Hxe/ NJPOJgN `LJfNN`BHyp/N8POJfN`*Hyt/N POJfN`HyxHxN bPOpL N^NuNVHG J |D  fNp`>HyHxNPO gHyHxNPO`HyHxNPOpLN^NuNV |E 9V |Dp./bin/echo.bin 7442 77777 77777 1565 4007601663 6744 0`J\HHfJg`6J+fp'@`Jg n R'pJf` `~`< `pL N^NuNV/ &nHH g\` +&_N^NuNVH0GE/ N.N XOp*/p*/p/pмl/p+/p+A\/0Hy/.N L N^NuNVN^NuNVH0$n &nBBBB  g  g  g  fR` +fR` -fp-@RB A\Dg Z_DJgHHм `HH.p0nr9m0`panrfm Wv``Hx /N П, Ї(RR`Jfp`P A\Dg Z_DJgHHм `HHrhf,R`Jg./bin/find.bin 7442 77777 77777 7527 3721476735 6766 0*ECC started onoffUsage: ecc [-e] [-t n] [on] [off] Error correcting memory is turned on off *Error detected on ECC is not enabled *ECC disabled Single bit error - MCU %ld, Addr %02lxxxxx, Row %ld, Column %2ld Multiple bit error - MCU %ld, Addr %02lxxxxx No error correcting memory in the system Option '%lc' has invalid argument @(#)ecc.c 1.5 (1/22/87)1Q68010 XPU 151 Ecc source 1.5 Copyright (c) 1NnpN^NuNV |E 9V |D 9VNBpN^NuNVHGvHxDNXO.HxHNXOHxLNXOgHHyHxNTPOHxNXOHyHxN:PO |E 9V |Dpr `pLN^NuNVH,.G м @  f pDfNdHxNxXO`p`H`D fFHyHxNPOJZg&HyHxNPOHxN>XOHyHxNPOHxNXO fp`~pDl~pHl~ Rм @ Tм @ @gr 0@"¼?ApHyHxNPOp./p./ 2 $#NVH0N&n E/ HyNPO-@Jg ËҀË``\ 9gr`p".`, +g A `A //Hy/NXJfJ f Hy /NPOp`Hy"HxNPOpL N^NuNVN^NuHop0//NP6N@FNuNVH0| n $p" g JR -fgR -f`J*WDHH* JRHH.JgtpA_Dg rZ\DJg м ` .&n`Jf`J\HHfJg`6J+fp'@`Jg n R'pJf` `~`< `pL N^NuH $oL /N@QHUHH %(FL|.^#V#bkW%%+}< ͕8!F͐F!@F_88I/8~( _8͐: G*] ͕ܐ"]+ : #6Đ: G !  ./bin/flush.bin 7442 77777 77777 3007 4007601753 7140 0hell-p(!2B8~(<=2 !M7!;7fdcbBad type operand Missing type operand '0^fn R7'z!T7nc"'V^fn'V ^ f n *R *R: (+( ?(8 2  =|0 W&kmSy??< x(  { (#~#+(-(+2 - "S!T!`7Bad number Missing number 5 (#*K 8V^R(.}=2 !7- 8z(7!Missing user name Unknown user name ͔ (*K 8V^R(! 7R@eL?A2/?A"/ /2/2/HABAdS@ԯ/@/BLNu/A2/`H $oL /N@QHUHHLNu /"/N@UHHNu"_" _N@UHH//N"/ / o "oN@UHHNu@ @  6Illegal number: "%s" Usage: Flush seconds @(#)flush.c 1.2 (1/22/87)1Q68010 XPU 151 Flush source 1.2 Copyright (c) 1986 Cromemco, Inc.  @! DH B!2 TNVpH0Nd&n E|B/ HyNPO-@Jg ËҀË``BHxBN Jf^BB/ Hy N.Jg`jHntHxHn/N.Jf.g HnNvXO`/NXOpg`*`Jg KX/NPXO`BHxBN `,BHy /HxNp`HyHxNPOpL N^NuNVH0$nBB/ N ,JmHn/NPO&@JgvHxHy/#(w#"]: G *]~(!  RWrong number of arguments .*B2 2 !_B8.y(.: Gy=x(/(y=: ( 2 0ɠ!: !7Too many right parends Unknown binary operator (!hB!0!0!7(!hB!8y ~#foMissing operand Unknown operator  # #~ 7)-a-o(!-blocks-exec-group-links-mtime-name-ok-print-size-type-user)(;cbTp KRKK}RK$! 4o!B8 y 2 JNV/ N&n / HyNPO-@Jg ËҀË``BJf`2 R͖ʹ(ߗ(*]|(Ͷ8>2 =ɗ!7Missing name : /2 ! !=2 %s ~. .(M (y[(A*(?( n#~ d(a*(Y* 0Ix ~.(?#~  (0](,(O-  (](8y0(](~(7! s#r#s#r#(!   ! sr##z ! nf|(> ##! Z>  y^Vz## # ? ;{}s -fp-@RB A\Dg Z_DJgHHм `HH.p0nr9m0`panrfm Wv``Hx /N П, Ї(RR`Jfp`P A\Dg Z_DJgHHм `HHrhf,R`Jgp` .g"D`"$ L N^NuNVH0G$n 'n / HxBNVPO.$ L N^NuNVHnHxRN2PON^NuH0/2/ AH@B@2/Ё/@L.Nu//lD//lDa:Jo lDJolD/_.Nu//lD//lDaJo lD/_.Nua.Nua /o.NuJof&/p0/?@0/?@H@?@ NuH$/r2/0/~TG!0( 7~TG 0( 7DM ++~ h P ͝ 8 (7! ͇ 8$%%%%oh 7 0:8 ag?'0!  8(%%% J  0:?0Ʌo$A[ Ʌo$~# ~# ./bin/free.bin 7442 77777 77777 5424 4007602060 6735 0 F/.NBPO/N:PO .L N^NuNVN^NuNVH0| n $p" g JR -fgR -f`J*WDHH* JRHH.JgtpA_Dg rZ\DJg м ` .&n`Jf`J\HHfJg`6J+fp'@`Jg n R'pJf` `~`< `pL N^NuNVH0&n $n .SJggrt `RR`pL N^NuNVH0&n$n JRgR` L N^NuNVH0$n G'n'n'n / Hx NPO.Jg `$pL N^NuNV-nHnHx NPON^NuNV/ G'n'n 'n / HxNtPO&nHx/ N*POp*м0&p2gr3f p0*"'@p*VDHH'@p*'@p*'@ p*'@p0*'@p0*'@p0f"*`p"'AHj.N%nXO'@ L N^NuNVH0$nN  l HxNXON&@/ / N.POHx/ N.HkN Hx NXOL N^NuNVH0$n&n Hx / N(POHk$/ N$POHyAHx/+/+ /+/+Np/HjdN /N$|POHyAHx/+HjlN| /N$ZPOHyAHx/+HjtNZ /N$8POHyA Hx /+Hj|N8 /N$POHyA"Hx HyBtN$(XO"+ /HjN /Ndevice Cannot read block %l,u @(#)free.c 1.4 (9/17/86)O11Q68010 XPU 151 Free source 1.4 Copyright (c) 1986 Cromemco, Inc. r/etc/passwd/dev/lptxsh-csh-cHk$NPOJgHk$HyAVHxN, ~`Jf /+N DXO`` LN^NuNVH0$n~N  l HxN XON&@/ NXO,JgJ/ / N~POHkN XO(/ N XOVDHH*Jgp#PX RJfJCg&BN$|XO&@JgA$// N$POJgN `NpL N^NuNVVH0*.&nEpJC*g/ Hy@N!POJf`Hxe/ N&POrdl/ Hy@HxN5 `JCg( Ep(g/ Hy@HxN5 `Hn\Hx / N0$ .JgB/ /HxN5p`// N$PO/ Hj$N(PO Ep(rdp0.//.\/ N/ / N*.JgB/ /HxN'`2HnHx/N"* g~`//NtPO.B/N`XOJg/NXO L N^NuNVH,. Jg2N b.o ` ./N //.N /N XO`LN^NuNVH*. BHxNXO&@JgVN .o ` . l ` <.// /.N /N $// N( /N XO`/ NhXO LN^NuNVH0&n$n Ю.`gp` RRnpL N^NuNVH0&n Ю$@`>Hn // /.Nl.JgBB/HxN%tND .ËҀË nL N^NuNVH&nHnHx/ N .&_N^NuNVH0G$n'n'n / HxNDPO.Jg `$ pL N^NuNVH0$n G'n'J'n / HxNPO. n L N^NuNVH0G$n'n'n 'J/ Hx!NPO.Jg `P . SkF n>H0;N$$$$$$$$$*6666**$$ ` + ሀ$pL N^NuNV/ G'n'n 'n / Hx5N4PO&_N^NuH0/2/ AH@B@2/Ё/@L.Nu//lD//lDa:Jo lDJolD/_.Nu//lD//lDaJo lD/_.Nua.Nua /o.NuJof&/p0/?@0/?@H@?@ #POJg/+HyA$HjN#PO/N#POJCf*k+H@gS@fHx/+HjN L N^NuNVH,. Jg2N.o ` ./NF//.N /NBXO`LN^NuNVH0&n Ю$@`>Hn // /.N).JgBB/HxN0DN .ËҀË nL N^NuNVH0&nE/ N,8XOHjN,vBHxBN, / BBHx/ N+BHxBN, L N^NuNVH0&n$n / Hx / N*F L N^NuNVH0&n$n BHxBN,6 / BBHx / N+*BHxBN, L N^NuNVN  l HxNjXOHx N./bin/ftar.bin 7442 0 0 40650 4007602315 6465 0`/ /N POJgp` XJfp`pL N^NuNVH0$n &n` Jfp`xRR A\Dg Z_DJgHHм `HH-@ A\Dg Z_DJgHHм `HH".gJWDg /WDHHL N^NuNVH&n .f +/fT .f( +.f +/f KRp^/ N.NXO` /fRgh~`JJg /f`B Am Zo$ am zo 0m 9o _g .fR` KRp$SJfg /g / NXO````LN^NuNV/ &n KRf&_N^NuNVH0$nB&J ^fR` /fR`g /gR` /fVB/ N XO.Jg6p fHnHx %@ *gp` *,/NxXOJfN /NhXOJf// Hy@HxN4` JC$g8Jg/*/ Hy@HxN4`/*/ HyAHxN4JCg/ NvXOJg / NXO`p0g / NXO`rJCg HnV/ NPOBBHnd/ N,P.JgB/ /HxN48`V/ N./.dNPPO/.dN,XOJCg HnV/ NfPO Ep(rdp0.//.\/ N pL N^NuNVH0$nHx NVXO&@&P7n7nHxd/ N$PO/N.XO'@/ /+N&:PO#PL N^NuNV/ &yP`0+nf0+nf +`&S fp&_N^NuNVH0$n Jgpf / NXO.` pg~ B/ /HxN% LN^NuNVH0,.&n*. EPHnHx/ Nj .Jgpf/// N .`VfNHnHx/ N4 .Jf4g.// NPO.Jf/// N .Jf /NXO.`~ Jg// /HxN$D L N^NuNVH0&nEHn/+ NPOBHxBN /+HxHk$N /+HxHk$N /+HxHk$N Hx/+HxHk$NHx/+ HxHk$NHx/+HxHk$NHnBBHx Hk$NBHxBN " L N^NuNVlH0E#>Gp/ NdXOJgHk$/9PNPOJNuH$/r2/0/R@eL?A2/?A"/ /2/2/HABAdS@ԯ/@/BLNu/A2/`H $oL /N@QHUHHLNu /"/N@UHHNu"_" _N@UHH//N"/ / o "oN@UHHNu@@ |/etc/mtabUsage: Free [device device ... device] cromix/dev/%-5s %6l,d blocks %6l,dK %11l,d bytes Not a block /N&POHx NXON^NuNVhH0EBGp/ NXOJgJHk$/9PNPOJg J2gHk$HyA&NPOJgJ,gHk$HyA4HxN. J&g Hk$N2XOHk$NXO.Jg `JgFJ&g /+NXOHk$N%XOHk$/+N*VPO.JgHk$/+/HxN.@`r gSgSg&SfPg8/+Hk$N.PO.`XOp&Jg /NXOBL N^NuNV <Ю/HxN T"9PTPd$9PtPx/HxN\DHHN^NuNVH0GPtEPx m,$n. Pn Г&@&` R!k fBA `<$&kf м,/N&XO&@Jfp`& X/N6XO`L N^NuNVB/.HnBN^Jgp` .N^NuNVH0$nYJDg yD&h Do#D` Dl o #D&k` yD!J%K&yD Гf k ѓ k'h`&k Гf k ѓ k'h`#D` #D%JL N^NuNVN^Nu"/g@ o/4|gSH4H@04<A` Qd`QNu$/ gL o"o02 |f|g `&|g SrB`"Qd$`QdNuNV/BHxHnHyCN .JgBHyC/HxNN ..N^NuNVH0GEN./ HxHxHx/N/. /./N / /NPOHyC/N|PO/ Hx/Hx/N /N XO A\Dg Z_DJgHHм `HHryWDHHL N^NuNVHGJPPglNNN./ HxHxHx/N THyC/NPOHn/NPO/ Hx/Hx/N $/N JBBBBNLN^NuNVHG..JPlgbHnB/ Hx /9CTN JfD/HxNn.p0+"ҀS/p0+/N./p0+/NB./HxNf. `P . SkF n>H0;N$$$$$$$$$*6666**$$ ` + ሀ$pL N^NuNVH0G$n'n'n 'J/ Hx!NXPO.Jg `P . SkF n>H0;N$$$$$$$$$*6666**$$ ` + ሀ$pL N^NuNVH0$nG'n'J'n 'n 'n/ Hx"NPOL N^NuNVH0&n $n-J-KHnHx$NPOL N^NuNVH0&nE/ Hx0NhPO.Jg `j jjpL N^NuNVH0E&n/ Hx2N PO.Jg `j jpL N^NuNV/ G'n'n 'n H,.B g  g g LN^NuNV .AB 0HH N^NuNV/.HyBHxN NN^NuNVH0&n < Ю$@` gp` R npL N^NuNVHG~`0/ Hx/Nv Jl`pf`/ /./NX RpnLN^NuNVHxHyP N PON^NuNVN^NuNVH0GCTEPhJg2#P@# PD#PX <Ю/HxN#P\HyCX/9P@NrPOJf8 9PDSgSgSgSfg/ HxNPO.` / BNPO.`HnHx/9P@N .Jg,pf$rPDfHxHx/ /9P@N&n` Jfp`RRgHHHHL N^NuNVH&n~` KRpf ` R o . LN^NuNVH0&n .ËҀË$KB .SJg&S/. Hx N r0ҟA /Hx N ` L N^NuNVH0$n &nBBBB  g  g  g  fR` +fR` -fp-@RB A\Dg Z_DJgHHм `HH.p0nr9m0`panrfm Wv``Hx /N П, Ї(RR`Jfp`P A\Dg Z_DJgHHм `HHrhf,R`Jgp` .g"D`"$ L N^NuNVH0&n$n JRgRPp&Pp 9P|/HxNF/NPOѓ L N^NuNV 9PxN^NuNV <Ю/HxN ѹPxN^NuNVH0EPtGPx P|m, 9P|/HxN/NPOѓ&Pp$Pp 9P|L N^NuNV 9PtN^NuNVH..GPt/HxNj ѓ/HxN.g </ Г/NPOLN^NuNVH.. &nJPlg// NPO.` // NPO.߹Pd LN^NuNVH0E &n* " Ҁ,/ // /9CTN(. ËҀËJfn м/HxN$pfBJfJf~JgBB/HxN8N$/ g o"o`QNu"/g8 o4|gS4<A` Qd`QNuNVH0$nG'J'n . '@ < '@/ BNHPOL N^NuNV/ &n-KHnHxN$PO&_N^NuNV/ &n-KHnHxNPO&_N^NuNVH0$n G'n'n'n / HxNPO.Jg `$pL N^NuNVH0$n G'n'n'n / Hx NPO.Jg `$pL N^NuNVH0&n E%n/ Hx NFPO.Jg `&pL N^NuNV-nHnHx NPON^NuNV/ G'n'n / Hx NPO&_N^NuNV-n / Hx5NPO&_N^NuNVH&nHnHx:NPO.Jg `&pLN^NuNVH0G..$n Joplp"`p'GA f SAD "0` "'A/ Hx@NBPO,Jg `2 n-H SAD "+fC ` + n pL N^NuNVH0$n G'n'R'n 'n/ HxPNPO.Jg `$pL N^NuH0/2/ AH@B@2/Ё/@L.Nu//lD//lDa:Jo lDJolD/_.Nu//lD//lDaJo lD/_.Nua.Nua /o.NuJof&/p0/?@0/?@H@?@ NuH$/r2/0/R@eLNV|H0E|&nJfp`HyHxBHxBNHyTHxN DPOHx/ BNv .HyHxHxHxBNHy`HxN POJfJgJgBB/HxN p`$/ / NPOJgp`HybHxN POpL N^NuNVH0&n$n ` Jfp`fRR A\Dg Z_DJgHHм `HH-@ A\Dg Z_DJgHHм `HH".gpL N^NuNVN^NuHop0//NP6N@FNuNVH0G$n B` n 0 xo nxx``Rp n R R B3xHn/ N*POHx/ HnNJ Jfp`pL N^NuNV@D AD@ @`FB(Usage: Ftar -{ctxy}[diuvwrn] [-k size] [-b bsize] archive [file_list] 00000.temp.tempIllegal archive size "%s" Illegal buffer size "%s" Create %s? Path "%s" is too long Not dumped: "%s" File "%s" too big: %l,d bytes Creating "%s" --> %s Creating "%s" nrfm Wv``Hx /N П, Ї(RR`Jfp`P A\Dg Z_DJgHHм `HHrhf,R`Jgp` .g"D`"$ L N^Nu"/g@ o/4|gSH4H@04<A` Qd`QNu$/ gL o"o02 |f|g `&|g SrB`"Qd$`QdNu$/ g o"o`QNu"/g8 o4|gS4<A` Qd`QNuNVH0$n G'n'n'n / Hx NPO.Jg `$pL N^NuNV-nHnHx N`PON^NuNVH0$nG./bin/group.bin 7442 0 0 10233 4007602420 6654 0 @ tUsage: group /etc/groupCannot find group "%s" Password: Invalid password @(#)group.c 1.2 (1/22/87)shell-z1Q68010 XPU 151 Group source 1.2 Copyright (c) 1986 Cromemco, Inc. 2ZcYyk(d)Pv,||*B EF~NRq0bB$LgLz]j{FbI?A2/?A"/ /2/2/HABAdS@ԯ/@/BLNu/A2/`NVN^NuBH />A/N8hXLDXNuaaaaaaaaNV/.HyD@HxNl HxNXON^NuNV-nHnHxFNPON^NuH $oL /N@QHUHHLNu /"/N@UHHNu"_" _N@UHH//N"/ / o "oN@UHHNu@ @ @ @ @!@H0&n $n/ N(XO.Hn/NPO/ HnNPOL N^NuNVH0$n&JzBx `` KRHH.pA_Dg rZ\DJg м ` . , VDHH  n&J *gzSJf L N^NuNVH&n BBB`,Jl, A"0ӓcRA  Rp nLN^NuNVH0&n$n (p*B` *pA  Rpn~`( ,pora`p" Ёx (SJl~`( ,pora`p" Ёx *SpoB*L N^NuNVN^NuNVH0G$n / S// /.NX,Jg `LJg@ S2%l,d bytes 1Extract %s? Extracting "%s" Comparing "%s" Compare ERROR "%s" Checksum error %ld blocks skipped %11l,d %lc %5ld:%-5ld %lc %s --> %s BBBDBHBLBPBTBXB\B`BdBhBlBp%s %02ld, %4ld %02ld:%02ld   Intrinsic error #%ld @(#)ftar.c 1.24 (1/21/87)JanFebMarAprMayJunJulAugSepOctNovDecE A_1Q68010 XPU 151 Ftar source 1.24 Copyright (c) 1986 Cromemco, Inc. ctxy'n'n 'n 'n/ HxN(PO.Jg `$ pL N^NuNVH0$n G'n'J'n / HxNPO. n L N^NuNV/ G'n'n 'n / Hx5NPO&_N^NuNV/ G'n'n 'n / Hx7NxPO&_N^NuNVH0G..$n Joplp"`p'GA f SA"0` "'A/ Hx@NPO,Jg `2 n-H SA"+fC ` + n pL N^NuNV/ &n-KHnHxINPO&_N^NuH0/2/ AH@B@2/Ё/@L.Nu//lD//lDa:Jo lDJolD/_.Nu//lD//2 0 NVHN@&n Jg/+NXO,pf~`BHxBN  /HxBN 2 /HxHxN BHxBN HyHxHxN * HyHxHxN  HyN XO.BB/HxN `HyHxN PO~ LN^NuNVpH0$np-@pBBHntHy0N^.JfHxHn/.tNz .Jf2HxA&H/HnN ro`/ /NTPOJg``/.tNFXOpf/ HyA/N XLDXNuaaaaaaaaNV/.HyHxNl HxNXON^NuNV-nHnHxFNPON^NuH $oL /N@QHUHHLNu /"/N@UHHNu"_" _N@UHH//N"/ / o "oN@UHHNu @  ./bin/help.bin 7442 77777 77777 31043 4012471025 6761 0 7n:  KRHH0 0m 7n  KRHH0`R.f `pLN^NuNVH.&nBR KRg6 ]f Jg `p`&f| -fRmg ]gn|`pLN^NuNVNN*N^NuNVH0G@ E@.`N>SJf 9@@olN&JgBJgHn 9@@//9@/N/NXOHnHnHnBNBNXOHn/.NPONlL N^NuNVNHy1\NXO(<A@*E0^`*H@g8U@g @fgTHj/.N PO&Jm Fp"Ё1`tHj/.NhPO&Jm Fp"Ё1`J//Hj/.N&Jm0 Fp"Ё! Fp"Ё"R1 ڀ XA0 n:BHxHnHxN& L N^NuNVNNHxN(2XON^NuNVH0GE"/ Hx/9@HxBN/ Hx/9@HxBN/ Hx/9@HxBN/ Hx/9@Hxd/NT 9@@/Nr,p o~` pdo~`~Hy1z//HnN /NPOHnN|XOLN^NuNVH0E@GJ2gHx HxNPOHj0NXO`6Hx HxNPO0*HS.`Hx HxNPOSJnHx HxNPOL N^NuNVH0$nG@J&VDgJ,VDHH.0+H// N POS-@2+H/HxNf"_, SJoHx HxNPO`JgHy1HxNPOHk$NXO`Hy1HxNPOHn/./ HxNJg Hk*NXO`Hy1HxNtPOL N^NuNVH0$nG@J&VDgJ,VDHH.0+H// N*POS-@Jg Hk$HnHx0HxHxBNHnHx09@HS/Hx BNNNZN H@mJ@mgS@gS@gW@fg@k @nH0;Ndxp@WgS@gBU@g @fg 9@@lN`N `n 9@@lN|`N `TN`NN`HN`BNr`<`>p#@$NNr`(B@$NNb`N\`J0 gNR`NP`/ Hx(/HxBNHnHx0/.HxBNHnHx/.Hx BN rWDHHL N^NuNV/N D A\Dg Z_DJg HHм ` HH.N^NuNV#@@B@NnN^NuNVHG n ` n BB`BBHxHxN/.N XO L N^NuNVH0(. &n$K* Є/Hx N2( ÊҀÊB SJgR0*Hg>Hx/ NPO.rm`R S2gSB Ї& SJg SS C``B` E ! KRg`Rn E B L N^NuNVH0| n $p" g JR -fgR -f`J*WDHH* JRHH.JgtpA_Dg rZ\DJg м ` .&n`Jf`J\HHfJg`6J+fp'@`Jg n R'pJf` `~`< `pL N^NuNVH0$n &n` Jfp`RRg  Z_DJgHHм `HHrhf,R`Jgp` .g"D`"$ L N^NuNVH0&n$n / NXO&@Jg&Hx/ / Nj Jg +:fp`p``pL N^NuNVH0&n$nB/ N`XO&@JgHx/. / N Jg +=fVB 0m 9n KRHH0( :gvlnJfp` ^f.RJg :fp`| R KRHH¼`, \fRH@m^@mgY@gQ@gXY@gdU@fgx@mfg@k @ nH0;N|||||||| @0fp` Rr R` Rr R`~ RrR`p@ 0,1dpUsage: Help [-p] [-d directory] [topic-list] /usr/help/etc/termcapsdlidcosclshosalscmssossesce sku skd skr skk .hlpDirectory of topics: %-9s%lc Topic ? .hlp/No help `<$&kf м,/N&XO&@Jfp`& X/N6XO`L N^NuNVB/.HnBNJgp` .N^NuNVH0$nYJ2xg y2x&h 2xo#2x` 2xl o #2x&k` y2x!J%K&y2x Гf k ѓ k'h`&k Гf k ѓ k'h`#2x` #2x%JL N^NuNVN^NuNVH0$n G'n'n'n / Hx NPO.Jg `$pL N^NuNVH0&n E%n/ Hx NFPO.Jg `&pL N^NuNV-nHnHx NPON^NuNVH0&nE/ HxNPO.Jg `&./bin/icheck.bin 7442 77777 77777 16212 4007603007 7261 0 n pL N^NuNVH0$n G'n'R'n 'n/ HxPNPO.Jg `$pL N^NuH0/2/ AH@B@2/Ё/@L.Nu//lD//lDa:Jo lDJolD/_.Nu//lD//lDaJo lD/_.Nua.Nua /o.NuJof&/p0/?@0/?@H@?@ NuH$/r2/0/R@eL?A2/?A"/ /2/2/HABAdS@ԯ/@/BLNu/A2/`NVN^NuBH />A/NTXLDXNuaaaaaaaaNV-nHnHxFNPON^NuH $oL /N@QHUHN PO&@Jg$ ,fR/NXOJg y2L 0`L N^NuNVH0E2@p$`/Hy2TNPO&@Jgp+gp+gSfgR0 `R0`R0B2PAN/Hk@NPO +$2Pg\J f/Hy!HxN p#0`6'y2P$/Hy2TNPOJf/Hy!0HxN p#0`R0`/Hy HxN p#0Rp090JdL N^NuNVH0E2@p$`R/Hy2TNPO&@Jg p+gA/Hk@NPO`/Hy HxN" p#0Rp090JdL N^NuNVH0E"GHy"HxNPO/90Hy Rr R`b Rr R`T RrR`FzB`  KRHH0,SJg 0m 7o R` R KR` R KR` Єm`" SJg Rr`B2x ```pL N^NuNVH0$n A-H&nBBBB JRgF %f4 JR H@mg0[@g@f g@9gW@gY@gS@g @fg .X @"*0Jox`Bo .ڀJgR +f JRHHڀ|. .f KR`pB`/Hx N * x/Hx N*Rpnpl$"SJ6f dg"HH0lS` SJg KR6xHHм0``, JRHH available on topic "%s" 11 Again Begin Exact Find Print Quit Return Up /bin/spool.bin11@(PRESS SPACE BAR TO CONTINUE % MORE ------ ------Insufficient memory @(#)help.c 1.11 (1/20/87)Find:Exact find:spool-n1Q68010 XPU 151 Help source 1.12 Copyright (c) 1986 Cromemco, Inc. tc=++++++++Unexpected signal number %ld  n pL N^NuNV/ G'n'n 'n / HxNPO&_N^NuNVH0G$n'n'n / HxN|PO.Jg `$ pL N^NuNVH0$nG'n'n 'n 'n/ HxN0PO.Jg `$ pL N^NuNVH0$n G'n'J'n / HxNPO. n L N^NuNVH0$n G'n'J'n / HxNPO. n L N^NuNVH0&n E%n/ HxNvPO.Jg `pL N^NuNVH0$n G'n'J'n / HxN0PO. n L N^NuNVH0$n G'n'J/ HxNPO. n L2@ ^NVtH0N &n E/ Hy NPO-@Jg ËҀË``NJfXBBHn|Hy""N.Jg`nHntHx/ /.|N^.Jfg/ NjXO"`pg`6`Jg KX/NHXO"` 9"`,Hy",HxNPOp`BHy""/HxNpL N^NuNVpH0B0B0B0B0B0B0B0 B08B04B00B0,B0(B0$B0 B0/.HnN POHnHy"pHxN8 Hx 9 gr`p"/Hy0/ HxN/90,Hy#J/ HxNHy#\HxNPO/90Hy#^/ HxN/90 Hy#l/ HxN/90Hy#|/ HxN/904Hy#/ HxN/908Hy#/ HxN/90Hy#/ HxNL N^NuNVH0$n &nB`/ / /N RXpnL N^NuNVH0.. $nJgl/NXOJo`/NxXOJgTHn/NPOJg/Hy H0;N$$$$$$$$$*6666**$$ ` + ሀ$pL N^NuNVH0G$n'n'n / Hx(N(PO.Jg `$ pL N^NuNVH0G..$n Joplp"`p'GA f SA2|"0` "'A/ Hx@NPO,Jg `2 n-H SA2|"+fC^ ` + n pL N^NuNVH0$n G'n'R / HxENNPO.Jg `$ n  n pL N^NuNVH0$n G'n'J'n'n/ HxKNPO.Jg ` p0+ XS/HxNp0+П#2D# 2H"92H2D./N XO$@Jf` 2D#2LJ g /9 NXONJ0fJ gN`NJ0fNJ0gNN4// N PO/90`vHn.+/NDPOJg/Hy Jg~``~/N XO`~ `Hy,HxN 4POpL N^NuNVxH0$n /.Hn|/ /.N4&@JgJg HkNXO`/ NhXO`~ L N^NuNVxH0&nEp-@x/ / NPO/./. Hnx/ N .JgB/ /HxN  .xLUHHNuDI$I$@@$@DA"@@@DB@  BHHH @"  @  "@"$ A L#smbInode %6lu, cannot read inode Block %6lu, cannot read block Block %6lu, inode %6lu, bad block number HxN Hk(NXOHyHyHxN Hk.NXOHyHyHxN Hk4NXOHyHyHxN Hk:NlXOHyHxNPOB`A@ "Ҁ/NXOXpnL N^NuNV/ &n/+ /+/+/HyHxN&_N^NuNV/ &np+/p+/p+/pмl/p+/p+/HyHxNR &_N^NuNVH0EjG/./ NPO&@HyD/ NPO&@/. / NPO&@HyF/ NPO&@/./ NPO&@HnHyHHxN L N^NuNVH0.. &nE gHyL/ NPO&@ gHyN/ NPO&@ gHyPLN^NuNV .2DTDg 2HUDJgp`pN^NuNV/ &n/. NXOJf&HnHx/ /90H0;N$$$$$$$$$*6666**$$ ` + ሀ$ N^NuNVH..&n HnHx/N d pfXHnHx/N pg&HxB/N HnHx/ /N `BBHx)HxN `HyjHxN PO LN^NuNVH0&n,. S/Hy~HxN n p0( bHyHxN PO`v n p0("Ё./B/.N HnHx/ /.N JgHyHxN >PO`$/HyHxN * м$@ L N^NuNVH0$nG B`h/HyHxN B`8/HxN JfHyHxNPO JRp/HyHxN RpnHyHxNPO mL N^Nu / NPO&@ gHyR/ NPO&@ L N^NuNVN^NuHop0//NP6N@FNuNVH0$n &nBlF RHr/ NPO&@Jg. ,fR  g  g  g  fR`Jf ``pL N^NuNVH0&n EF`RRg4 A\Dg Z_DJgHHм `HHHHgg . ` /HyF/.N*PO/N"PO .L N^NuNVN^NuNVH0| n $p" g JR -fgR -f`J*WDHH* JRHH.JgtpA_Dg rZ\DJg м ` .&n`Jf`J\HHfJg`6J+fp'@`Jg n R'p vHxz/NPOJgJ0g`BHxl/NzPO.Jg6HxP/NPOrlHy!HxNPOp`/Hy1,NPO`Hy!Hy1,NPOHxn/N PO.JgLHn/NfPOJgp@n oHy!HxNPOp`/.HxN& h;`BpgpVDgJVDJgp `p`pgp `p"R//N h;`4Hxl/N~POJfHxn/NnPOJgHy!HxNPOp`Hxu/NJPO.Jg~J0f`Hy0/NPO. 90gggf(gB0`2p#0`(p#0`p#0`Hy",HxNPOp`pfpg2/2/HABAdS@ԯ/@/BLNu/A2/`H $oL /N@QHUHHLNu /"/N@UHHNu"_" _N@UHH//N"/ / o "oN@UHHNu @@@   B@H  $$$@@  @ |8TxiIllegal number "%s" Usage: Idump [-x] [-i inode-list] block     A B0H7A7j`l XA B0H7A7j`N PA B0H7A7j`p ВA B0H7A7j`p7@r7AA r'H`p7@r7AA 'H`p7@r7A`p 7@r7A`Vp7@Bk`p7@Bk`\p7@r7A`tp 7@r7A` p. /Hy#`HxN p`A &X'HC'I P'Hp`jA 'HA &C'I C'Ip`DA x&C 'IP'I A 'Hp`"A l'HA R&C 'I\'I pL N^NuNVH0.G1|A,. g/r./NPOJgp`/ F./bin/initflop.bin 7400 77777 77777 23373 4007603243 7661 0gHy$pHxNPO`Hy$HxNPOL N^NuNVH0,... *.E0G0JfJ/Hy$HxN HxPHnBN J.fB`/ HnN POJf`l``J g/Hy$HxN JfZ//Hy$HxNjHxPHnBNp J.f%G`HjHnN POJf`m *l``J g/*Hy$HxN JgJf`/Hy$HxN HxPHnBN .Hg @g@fB'F`/ HnNPOJf`l`'S`6J g. f/Hy%HxN z `Hy%.HxN fPO` JfBBL N^NuNVH0E&nHy%HxNPOp`Hxh/NPO.JgTHxHy0/N. (f`&pf #00 90̰0m0lHy"THxNPOp`~HnHx /90N J g&JfHy"fHxNPO/.Hy"rHxN JfHy"HxNPOpg &m$ 2npf" am ooHy"HxNPOJ gJfHy"HxNPO/N4XOp gvJ gJfHy"HxNPO/ .S//ND J gHy"HxNPO_device [inode-list] Not a block device Inode %6lu, Illegal inode number Cannot read inode byte %08lxh %04lx: %02lx %-30s%-30s%l,d %-30s%s %-30s%l,d %s %-30s%ld:%ld n|User IdGroup IdAccessFile TypeAllocatedNumber of LinksbytesFile SizeInode NumberParent InodeDirectory CountSpecial Device NumberblocksUsageCreatedModifiedAccessedDumpedBlock Pointers: %10l,u%10l,u%10l,u%10l,u %02ld/%02ld/%04ld %02ld:%02ld:%02ld ..%s rewa/NxPO&@~`/ F/(NbPO&@ A0!"KR"KR"KR"KR F/ F/( N&PO&@p.f fpf " Ҽx$AB` KRR < Fr2(㨰b/ F/(NPO&@R Fp0(dRp.gpN` <B` KRR m gp fp g.p g JRpS JRrM` JRpL JRrG`$ JRpCr¹ g JRrS` JRpLp g JRpD` JRpS JRpSr¹ g JRrD` JRpS JRpD`4~`$ A0&p"KR"KR"KRR Fp0(dpL N^NuNVH0E..G:JfJ2p8NVtH0NEG p@BA,f# `N/. Hy N^PO-@Jg Ѯ ``pg`zHxv/N POJgp# J gLJfHHy&Hy!HxNb Hy!HxNPPOHy!HHxN@POHy!dHxN0POJftHy!HxNPOHxPHnBN$ Hx HnHnN #0rf`J0gpgpgp(`pM-@`~J g n /Hy!HxN Hx Hn n /N: #0rf `J0gBp-@Hxd/NPOJfHxs/NPOJf ,POB`D 3Ax\Dg 3Zx_DJg3xHHм `3xHH6xHHg[`Rpn Z/A Z/NPOHx .// HnN,Jg`HnB/N N ,Jg`pgHy%BHxN rPOp`HnHx/N  ,Jg`pgHy%dHxN 8POp`~/. Hx/N ,Jg`NHnHx/N ,Jg`4pfr#0t#0`B0HnHy0NPO `BHn/HxN pL N^NuNV|H0E&.Gh,B-KB`B3xRpnB+p -@|p gp`p".|Ҁ. "ЁA r00er&_N^NuNVH0G$n'n'n / HxNPO.Jg `$ pL N^NuNVH0$n G'n'J'n / HxNPO. n L N^NuNVH0G$n'n'n 'J/ Hx!NPO.Jg `P . SkF n>H0;N$$$$$$$$$*6666**$$ ` + ሀ$pL N^NuH0/2/ AH@B@2/Ё/@L.Nu//lD//lDa:Jo lDJolD/_.Nu//lD//lDaJo lD/_.Nua.Nua /o.NuJof&/p0/?@0/?@H@?@ NuH$/r2/0/R@eL?A2/?A"/ /-y0`-y0`JfDJf>pf8p@=@tHy1|BBr“/r./NpJgp``>pgp`p@=@tHy1|/././r./N4Jgp`B.J g/./.Hy"HxN=nv=nxA1|-HzHnBHntHx/90N<(JgBHn/HxNBR .0oR .0o/90NdXOpg/N BXOJ gHy#HxNPOp`Hy# HxNPOpL N^NuNVH0$n &n KRp,JgB` JRRnR` L N^NuNVH0&n E0p. Yk4 n*H0;N">\z@(#)idump.c 1.4 (1/22/87)Ordinary FileDirectoryCharacter DeviceBlock DevicePipe FileNoYes=~1Q68010 XPU 151 Idump source 1.4 Copyright (c) 1986 Cromemco, Inc. r/etc/passwd/dev/lptxsh-csh-c*0fXHy#xHxNPOHxP/ BN * Hg@g@g @g@f ` ```RHy#HxNPOHxP/ BN p#0gHy0/ N rPOJf`J0m p0l``fJ g^p gHy#HxNPO`Dp gHy#HxNPO`*p g <"90/Hy#HxN JfPHy$ HxNPOHxP/ BN  Hg@g@g@g@fg ````0J g(p gHy$.HxNPO`Hy$ Sector size (0=128, 1=256, 2=512, 3=1024)? <2> Cromix disk CDOS disk Uniform disk with %ld byte sectors Single or double sided (S/D)? Double sided Single sided Single or double density (S/D)? Double density Single density First cylinder (0-%ld.)? <0> FirsNuNVH0$n &nBBBB  g  g  g  fR` +fR` -fp-@RB A\Dg Z_DJgHHм `HH.p0nr9m0`panrfm Wv``Hx /N П, Ї(RR`Jfp`P A\Dg Z_DJgHHм `HHrhf,R`Jgp` .g"D`"$ L N^NuNVH0&n$n JRgR` L N^NuNVH0$n G'n'n'n / Hx NvPO.Jg `$pL N^NuNV-nHnHx NDPON^NuNV/ G'n'n 'n / HxNPO&_N^NuNVH0G$n'n'n./bin/inithard.bin 7400 77777 77777 37311 4007603400 7627 0!  !@@ B  @A D@@ @ ,s&cdhlnsuvz * ( :PN 2N N 6N 2op&Hy1HxNPO` D(lp&Hy1HxNPOJmv#D,B/9@Hy2HxN HxPHynBN# 9ng / HynN#POJg @op&JlHy2&HxNPOJm#D0&@//9@Hy24HxNHxPHynBN# 9ngL/ HynN#zPOJg @op&Hy2THxNPO` D0lp&Hy2bHxNPOJmv#D4Hy2HxNPOHy2HxNPOp9[3DL"<¹D<¼f Jy`fJD(fJD0fr#0p#0(9D(`*9D0`x//Hy2HxN3DN3DP/ BHyDLHx/9D8N%j.JgBB/r/fRHn/NPO,Jf`*n n n Jg&J gp+/Hy& Last cylinder: %ld. Surfaces (0-%ld., All)? Surface: %ld. All surfaces /dev/Cannot initialize mounted device Cannot initialize write-protected device Labeling disk Disk name: %s Disk name (up to 8 characters)? UserdiskDate on disk: %02ld/%02ld/%02ld Date on disk (mm/dd/yy)? <%02ld/%02ld/%02ld> Number of directory entries: %ld Number of directory entries (64-512)? <%ld> @(#)initflop.c 1.7 (1/22/87)) / HxNPO.Jg `$ pL N^NuNVH0$nG'n'n 'n 'n/ HxNPO.Jg `$ pL N^NuNVH0$n G'n'J'n / HxNXPO. n L N^NuNVH0$n G'n'J'n / HxNPO. n L N^NuNVH0G$n'n'n 'J/ Hx!NPO.Jg `P . SkF n>H0;N$$$$$$$$$*6666**$$ ` + ሀ$pL N^NuNVH0&nE/ Hx0NXPO.Jg `j jjpL N^NuH0/2/ AH@B@2/Ё/@L.Nu//2'/NVH0N'E.G/ HxHxN,$ .JgBB/HxN.HxN.,XOpg4/ A2//N+ .JgBB/HxN.nHxN-XOpg`Hy;Hy0$HxN Hy0(HxNPOHy0RHxNPOHy0nHxNPOHy0HxNPOHy0HxNPOHy0HxNPOHxPHynBN& An, FgF F-H FprASDg FptZTDJg Fpм ` Fp nR`Hx HynNtPOJfvJ0g|Hy1HxNPOHxPHynBN& p9nrASDgp9ntZTDJgp9nмN(N , @, %s Press: RETURN to supply default answers CTRL-C to abort program Warning: INITFLOP can destroy all disk data Device name? Device name: %s Label name too long UserdiskInvalid number of directory entries Cannot specify CDOS label options on non-CDOS disk Bad sector size Bad cylinder numbers Bad head numbers Testing: Rotational speed: %ld RPM No index pulses or counter not functiHxN) J0gN.J0 fN &NB0RD4oRD,onHy2HxNPOJD@g2p09b&Jfp3bN3bJ0 fN zN 6/9D8N$hXOp`Hy2HxNPOpL N^NuNVHy2HxN(4POJ0g2JD@fJ0g"JybfRybNTJ0 fN LNHxN'XON^NuNVH0&nED8Hy2HnN"fPOB`D 3Ax\Dg 3Zx_DJg3xHHм `3xHH6xHHg[`Rpn Z/A Z/N"POHx . // HnN#,Jg`THnHx/N#N ,Jg`0pgHy2HxN' POp`0HnB// NPO&@Jg. ,fR  g  g  g  fR`Jf ``pL N^NuNVH0G$n / S// /.NL,Jg `LJg@ S2HH.p WDf r WDfp WDfp WDJf`S` B2pL N^NuNVH0| n $p" g JR -fgR -f`J*WDHH* JRHH.JgtpA_Dg rZ\DJg м ` .&n`Jf`J\HHfJg`6J+fp'@`Jg n R'pJf` `~`< `pL N^NuNV/ &nHH g\` +&_N^NuNVH&n~` KRpf ` R o . LN^1Q68010 XPU 151 Initflop source 1.7 Copyright (c) 1986 Cromemco, Inc. I08LlD//lDa:Jo lDJolD/_.Nu//lD//lDaJo lD/_.Nua.Nua /o.NuJof&/p0/?@0/?@H@?@ NuH$/r2/0/R@eL?A2/?A"/ /2/2/HABAdS@ԯ/@/BLNu/A2/`H $oL /N@QHUHHLNu /"/N@UHHNu"_" _N@UHH//N"/ / o "oN@UHHNu@A @ $B$R@@   A@ @@@  @ @ `p9nrygp`Hy1DHxNPO`JD@fHy1FHxNPOp`hJD@gN /9D8N(XOHxHxHyD8HyCN(@.JgBHyC/HxN,p`/ BHnHx /9D8N(.JgBB/HxN,H/N+XOp0.S#@r2.S#@B/9@Hy1xHxN HxPHynBN$ 9nghp9nrASDgp9ntZTDJgp9nм `p9nrxf`/ HynN$POJg @op&JlHy1HxNPOJmN#D(&@//9@Hy1HxNHxPHynBN$ 9ngL/ HynN$|POJg @ N# ,Jg`HyD Fp f`4 AC"R"Ar$R"Bt҂1R@Rp np0 gZHxHx/90 BBHyDVHxN9ƾgHy3HxN "PO` 90ADVC, B` Fp f`J0 ft Fp-@"A@$R"Bt1 R"@pЮ1"Fp-@$R"Bt1 R"@pЮ1`d A@"R"Ar1"R"Ar1"R"Arp"R"Ar1"R"Ar1"R"ArpTR@RnL N^NuA@r1`R@m A@11r L N^NuNVH0E@GVBn R/HxN <p0+ f^ R8B`L AC:0"H/NXOJg`*El H"H` H"H=@no87E R@mp0+ f& R8 H.`/NXOJf7G `SJfp0+ f* R8 H.`/NXOJf7G ` Rp0bp0+ fHy8POJm5k 9@Г/p*/N#@ 9@@ R4J0 f|p0*7A#@ 9DDUgSgSg[f 9DHSk nH0;N 0Txp@6r5At-Bp1@r7A`jp@62r5At-Bp4@r 7A`Fp@6br8At-Bp1@r 7A`"p@6r8At-Bp2@r7A`:6pS@rTAtDB`"6p@r@AtSBp-@r2Ap0S#@r+S#@HxHxBBBHyDVHxN9ƾfXr2gRr*gJr*gBr2*g:r2 g.r* g *+WDg *+WDJfB0pDDg rDDf p3DL` p+3DLByDNByDPHnHxHyDLPOB Fp0( / Fp0/Hy6HxNHxP/ BN Jf Fp0( -@` Hn/ NPOJg Fp0dBJfHy7HxNxPOJgz/.NXOJgHy7,HxNRPO`X F1n NN0Hrg N.N`Hy7LHxNPON L N^NuNVH0AV-Hp0 fr#0 t@#0 90ADVEHxHx/90 BBHyDVHxN 9ƾg`` n (2fp `p (B` A@G2Htf.<*<`J0 f<0+H2H驀=@2+H4+H骂6"t4.p᪂.`Z0Hr4+Hļr㪀4+NVH0GnE@AV*J0 g`JgNHy3HxNPOHxP/ BN gTprASDg ptZTDJg pм `prnf B` AC1Rp nB`<g8prASDg ptZTDJg pм `pryg`NHy3HxNPOHxP/ BN Jg4prASDg ptZTDJg pм `prnf`prASDg ptZTDJg pм `pryg`n g SACr20R`p"<.` Ep0/ H/Hy4HxN>HxP/ BN gTHn/ NPOJg Hn Ep0d` E0G@B`H 23Htf"% ` "43Hr% "43H…R@m/9@HxN ,`*` .` (2"҆%"҆%"43H($Ԇ7($Ԇ7(43H($Ԇ7($Ԇ7(43H($Ԇ7($Ԇ7(43H($Ԇ7($Ԇ7(Jm "҆$2nLR@m6/HxN ,JnL N^NuNVH0E@G BHy8hHxNPOHy8HxNPOHy8HxNPOB`x 22Htf`l 22H/22H/22H/22H//Hy9 HxNR/HxN vJfHy9>  D"t5"X A"<5R@ FJh g4Hy5VHxNPOHxP/ BN gprASDg ptZTDJg pм `pryfHx2 Fp(/B 42H/42H/HyFVHxN9ƾgHy5lHxN POHx Fp(/B 22H/22H/HyFVBNFJ9ƾf4Hx Fp(/B 22H/22H/HyFVBN 9ƾgHy5HxNPOR Fp0(bt`<g8prASDg ptZTDJg pм `prng`|0Hrf`Hy5HxN,POHxP/ BN grprASDg ptZTD &//9@Hy:lHxNHxPHynBN 9ng / HynN(POJg @op&JlHy:HxNPOJm5k 9DDUgSgSg[fgp0* f 9@R5@p0*&/ 9@R/Hy:HxN&HxPHynBN 9ng"/ HynNnPOJg 9@Rlp&JlHy:HxNPOJm5kHy:HxNPONL N^NuNVH0$n Gƾ`PBn 'J7n7n 7n 7nHnB/ Hx/9D8NJgpJf` S J fL N^NuNVN^NuHop0//NP6N@FNuNVH0G$n / S/Hx/9D8NL*JgBB/HxN"/N"rXO`p#0r2* gLr2*/r2*/N!.#0r2*/r2*/N!#0r*0br#0`p#0p0* gLp0*/p0*/N #0 p0*/p0*/N #0p*0 bp#0 `p#0 p0 g*r2*0/ 90 gr`p"/N ^#@6p0*@c 9@`p0*7@jj7j 7j 7jjp0*r*ЁS/p*/N#@ p0й@ S#@r*S#@ *Sf *2fx#@D,#@D4p0+&p0gHxHxHļ4+H€.0+Ht娀2+H¼ቀ* JX J0 g JX R np0(bHxHx/90 BBHyDVBN J9ƾf$HxHx/90 BBHyDVHxN J9ƾf`Hy7jHxN2POL N^NuNVH0GE,.Hy7HxNPO/9@Hy7HxN HxPHynBN J9nfp`/ HynN 0POJg @op$Jm/9@Hy7HxN HxPHynBN l 9ng / HynN POJg @op&JmJfJfHy7HxN6PO` B`D A@20Hf.20Hf$Hy8HxNPO AC1".R<R"H"Et4b``` Rp nnJgNN L N^NuNVH0EDVG0AV-Hpf r&B0HxHx/BB/ HxN9ƾg`dHx@HyC й0/NR HxHx/BB/ BNJ9ƾfHxHx/BB/ HxN`J9ƾf`Hy4fHxNPOL N^NuNVHGHy4HxNPOBB`\ ACr20 f`H ACr20/Hy4HxN R/HxNJfHy4HxNPORp n/HxNJgHy4HxNPOLN^NuNV(H0E@GnAV,BC"F=i C,( `* D Hr4.H€HxNPO`Hy9@HxNPORppn/HxN BJgHy9FHxNPOL N^NuNVH0GDVEAV-HHxHxBBB/ HxN9ƾg`VAhCVp S@nHxHxBBB/ BNJ9ƾfHxHxBBB/ HxNJ9ƾf`Hy9HHxN POL N^NuNVH0GEV 9DDUg_fg | .<`,9@.9@`| .<p*&//Hy9jHxN HxPHynBN 9ng/ HynNPOJgmJnp&Jmk S#@ 9@R&//Hy9HxN <HxPHynBN 9ng/ HynNPOJgmJnp&Jl / /.N,Jg `LJg@ S2HH.p WDf r WDfp WDfp WDJf`S` B2pL N^NuNVH0$n &nBBBB  g  g  g  fR` +fR` -fp-@RB A\Dg Z_DJgHHм `HH.p0nr9m0`panrfm Wv``Hx /N П, Ї(RR`Jfp`P A\Dg Z_DJgHHм `HHrhf,R`Jgp` .g"D`"$ L N^NuNVH0&n$n JRgR` L N^Nu"/g@ o/4|gSH4H@04<A` Qd`Qe (Y/N) ? Existing entry - surface= %ld cylinder= %ld Enter command (c=change d=delete e=end edit RETURN=next entry) ?  Alternate tracks require %ld cylinders Alternate tracks located at cylinder %ld Do you wish to change this location (Y/N) ? Cylinder number of start of alternate tracks (1 - %ld) <%ld> ?  Bad value Location contains bad tracks No alternate tracks declared Unable to write new alternate track table Enter bad track: Enter surface number - RETURN to end (02/HABAdS@ԯ/@/BLNu/A2/`NVN^NuBH />A/N.HXLDXNuaaaaaaaaNV/.Hy;HxNl HxNXON^NuNV-nHnHxFNPON^NuH $oL /N@QHUHHLNu /"/N@UHHNu"_" _N@UHH//N"/ / o "oN@UHHNu @@   @ H@B@@HA!B! DD  @ "HI @ I@B !"I@me Last cylinder must equal or exceed first cylinder First surface (0-%ld)? <0>  Bad value Last surface (0-%ld.)? <%ld.>  Bad value Last surface must equal or exceed first surface Formatting Surface,Cylinder %2.2ld %3.3ld Usage: Inithard Inithard interrupted. /dev/Cannot initialize write-protected device Cannot initialize this type of device Cannot initialize mounted device Cannot read partition table Cannot read alternate track table Do you wish to retain existing pg ng Nf`. yg Yf Hy!ZHxNPOHnHxNPO``Hy!HxNzPOHxP/ BND Hx Hn/ N2 #0*rf` <gHy!HxN(PO`Hy!HxNPOHxP/ BN Jg ng Nf` yg Yf p# ``J0.gHy!HxNPOp`Hy"HxNPOHxP/ BNv Jg ng Nf` yg Yf p# `6`Hy"BHxN`POHxP/ BN* Jg ng Nf` yg Yf p# `` 9 gr`p"/Hy"pHxN HxP/ BN Jf p# `6Hy / N6POJg"p mNu$/ gL o"o02 |f|g `&|g SrB`"Qd$`QdNu$/ g o"o`QNu"/g8 o4|gS4<A` Qd`QNuNVH0$n G'n'n'n / Hx NPO.Jg `$pL N^NuNV-nHnHx NPON^NuNVH0G$n'n'n / HxNPO.Jg `$ pL N^NuNVH0$nG'n'n 'n 'n/ HxN4PO.Jg `$ pL N^NuNVH0$n G'n'J'n / HxNPO. n L N^NuNVH0G$n'n'n  - %ld): Enter cylinder number (0 - %ld): Cannot delare track zero bad! Track already declared bad! Cannot find clear location for alt tracks Alternate track table # bad track alt track # bad track alt track # bad track alt track hd cyl hd cyl hd cyl hd cyl hd cyl hd cyl %3ld %2ld %4ld %2ld %4ld Unable to write new disk label Number of surfaces (1 - %ld) <%ld> ? Number of cylinders (1 - %ld) <%ld> ?  Bad value Number of @)@@! @" @I@ D @@@! @@@$  @ B ! @ @ @BHH   @@@ ! ! ! ./bin/inittape.bin 7400 77777 77777 22002 4007603532 7637 0artitions (Y/N) ? Do you wish to declare disk partitions (Y/N) ? Starting cylinder of next partition - RETURN to end (%ld - %ld) ? Unable to write new partition table Partition table %5ld Existing alternate tracks: Do you wish to retain existing alternate tracks (Y/N) ? No alternate tracks declared Do you wish to declare alternate tracks (Y/N) ? Salvage (Y/N) ? Salvage read unsuccessful Salvage write unsuccessful Do you wish to edit alternate track tabl 9 gr`p" o``nJ f&J gHy"HxNPOHnHxNPOJ g n /Hy"HxN^ Hx Hn n /N #0*rf `J0.g J f`H <gHy"HxNPOp`RB0"p#0&Hxs/NPO-@JgZHxHy0"/.N2 .f`(pf #0"0& 90&0"m r0&lHy"HxNPOp`Hxp/NPO-@Jg*Hy /.NPO.fHy#HxNDPOp`J g` J g BNXO`>J gp# BNXOHxdhHy4NZPOB` A0-p".t¼-A .'J/ Hx!NPO.Jg `P . SkF n>H0;N$$$$$$$$$*6666**$$ ` + ሀ$pL N^NuNVH0G..$n Joplp"`p'GA f SA;"0` "'A/ Hx@NPO,Jg `2 n-H SA;"+fCr ` + n pL N^NuH0/2/ AH@B@2/Ё/@L.Nu//lD//lDa:Jo lDJolD/_.Nu//lD//lDaJo lD/_.Nua.Nua /o.NuJof&/p0/?@0/?@H@?@ NuH$/r2/0/R@eL?A2/?A"/ /2/sectors (1 - 64) <%ld> ? Bad value Interleave factor (1 - %ld) <%ld> ?  Bad value Max number of alternate tracks (0 - %ld) <%ld> ?  Bad value Starting cylinder of disk (0 - %ld) <%ld> ?  Bad value Starting cylinder for write precomp (0 - %ld) <%ld> ?  Bad value @(#)inithard.c 1.20 (1/27/87)a1Q68010 XPU 151 Inithard source 1.20 Copyright (c) 1986 Cromemco, Inc. .6.8.:.<.>.@.B.DUnexpected signal number %ld @ 0 :@%s Press: RETURN to supply default answers CTRL-C to abort program To only do Alternate tracks and partitions answer "x" to "first cylinder" question. Warning: INITHARD can destroy all disk data Device name? Disk is already formatted. Do you wish to continue (Y/N)? You must initialize whole disk partition first First cylinder (0-%ld)? <0>  Bad value Last cylinder (0-%ld.)? <%ld.>  Bad valu2NVH0NG0E4BA ,pf # `*/. Hy NPO-@Jg Ѯ ``pg`vp-@Hxv/NXPOJgp# Hxd/N@POJgp# Hxe/N(POJgp# Hxf/NPOJgp# Hxc/NPOJgp# Hxx/NPOJgp# J gJ f8J f0J gJ f J fJ g&J fJ gHy vHxN@POp`JfHy&VHy HxN Hy HxN POHy HxNPOHy HxNPOHy!"HxNPOHxP/ BN J -@"<®-Ato@ l6po.Hx/.N"".ҟ//N".ҟC$9 R0mnNHxN,XO`hN JA0-HC-Ip=@J gJfHy#$HxNPO/.HxN PO 90"`p=@BnB`6 A0r20CB1 r20RR rbJ g&p/Hy#2HxN HnHxNPOHnBHnHx/90*N.JgBHy02/HxNTRp0&c8J f`>HxdhHy4NtPOB`B`A4pHx/NHxN П-@r=At=Br=AJ_DJgHHм `HHrhf,R`Jgp` .g"D`"$ L N^NuNVH0&n$n JRgR` L N^Nu"/g@ o/4|gSH4H@04<A` Qd`QNu$/ gL o"o02 |f|g `&|g SrB`"Qd$`QdNu$/ g o"o`QNu"/g8 o4|gS4<A` Qd`QNuNVH0$n G'n'n'n / Hx NPO.Jg `$pL N^NuNV-nHnHx NPON^NuNVH0G$n'n'n / HxNPO.Jg /N ZHxN R ПHx/+N BПЫ, raf"FJfR0 F 9 ` FgS0 FBR +oR +ovRld` 0]DHHL N^NuNVH0GE0Jg>pvrtAtoBpc@B` plA$xR mA4-HB0B`\B`NB`B .R @g2"90$p ԀԄ%R0 0oS0RpnR mRpn.90` r%R mB+p7@Bk Bk Bk'JHnB/ Hx/90*N d&JgBHy02/HxN g(p+/p+/p/Hy$HxN p@@B  @  m&.pecsfdvxPN 2N N TNOnly one of C, E, or X options may be specified. %s Press: RETURN to supply default answers CTRL-C to abort program Warning: INITTAPE will destroy all tape data Do you wish retension delay of 180 seRpn Z/ Z/N6POHx ./Hn/ N:,Jg` gHy%HxNlPOp`Hy0.Hx/.N^ ,Jg`t0.HnHx /.N8 ,Jg`N ^lHy&HxNPOp`D/. Hx/.N ,Jg`/ Hy02NbPO .`B/ /HxNpL N^NuNVN^NuHop0//NP6N@FNuNVH0$n &nBlF RHr/ NPO&@Jg. ,fR  g  g  g  fR`Jf ``pL N^NuNVH0G$n / S// /.N,Jg `LJg@ S2HH.p WDf r WDfp WDfp t Sectors %6ld %8ld %3ld Total bad sectors %ld First stream (0-%ld.)? <0> First stream: %ld. Last stream (0-%ld.)? <%ld.> Last stream: %ld. /dev/Cannot initialize mounted device Wrong version of tape drivers @(#)inittape.c 1.2 (12/16/86)1Q68010 XPU 151 Inittape source 1.2 Copyright (c) 1986 Cromemco, Inc. I0i@ g*p/ R/Hy#N/NHnHxNPOHnBHnHx/90*N.JgBHy02/HxNzRprbRR m@pgVN 0oHy#pHxN"POJ g" 0l 90` <#0` NRJg``HxNXO/90*NXOJ gHy#HxNPOp`Hy#HxNPOpL N^NuNVH0GE4B0Hy#HxNPOHy#HxNPOB`B`BB`| JRgrJf//Hy$HxN~R0 R/Hy$ HxN HH fHy$&HxNPO` op*`p /Hy$(HxN Rpn~JgHy$,Hx`$ pL N^NuNVH0$nG'n'n 'n 'n/ HxNHPO.Jg `$ pL N^NuNVH0$n G'n'J'n / HxNPO. n L N^NuNVH0G$n'n'n 'J/ Hx!NPO.Jg `P . SkF n>H0;N$$$$$$$$$*6666**$$ ` + ሀ$pL N^NuNVH0G$n 'n / HxBN>PO.$ L N^NuH0/2/ AH@B@2/Ё/@L.Nu//lD//lDa:Jo lDJolD/_.Nu//lD//lDaJo lD/_.Nua.Nua /o.NuJof&/p0/7@Bk Bk Bk'JHnB/ Hx/90*N &JgBHy02/HxN g(p+/p+/p/Hy$HxN TJfg"B0B` r%R m`Hy%HxN POHy%8HxN POp-@-@B0` 90-rrf` .r* ., <(fg//Hy%THxN -E-F R/Hy%bHxN p R0 0mh/90Hy%hHxN D L N^NuNVH0$n &n KRp,JgB` JRRnR` L N^NuNVH0EBG4/ Hy PNPO&@B`~/ Hy \NPOconds (Y/N) ? Please wait for tape retension time (180 seconds) Device name? Cannot initialize subsections Do you wish to examine VTOC only (Y/N) ? Cannot inititialize write-protected device Do you wish to edit VTOC only (Y/N) ? Do you wish to VERIFY tape only (Y/N) ? Number of VERIFY passes ? (%ld-10) <3> Please wait for tape retension time (180 seconds) Device name: %s Cannot initialize subsections Bad stream numbers Bad pass number Formatting Initializing stream %WDJf`S` B2pL N^NuNVH0| n $p" g JR -fgR -f`J*WDHH* JRHH.JgtpA_Dg rZ\DJg м ` .&n`Jf`J\HHfJg`6J+fp'@`Jg n R'pJf` `~`< `pL N^NuNV/ &nHH g\` +&_N^NuNVH0$n &nBBBB  g  g  g  fR` +fR` -fp-@RB A\Dg Z_DJgHHм `HH.p0nr9m0`panrfm Wv``Hx /N П, Ї(RR`Jfp`P A\Dg ZNPOR mZRpnJL N^NuNVH0GE0Hy$.HxNPOHxP/ BN L Jg ng Nf 0]DHH` yWDf YWDJf`pgHy$Z/N POHxP/ BN A\Dg Z_DJgHHм `HHg8 raWDf tdWDf reWDJf`t ref`VBpgTHy$xHxN|POHxP/ BNF Hx/ / N *po lrmJfB`SJlBv`&(JlB-|` -k-kJl Bp-@` -k-k&`'n`'n`jA4Hx?@0/?@H@?@ NuH$/r2/0/R@eL?A2/?A"/ /2/2/HABAdS@ԯ/@/BLNu/A2/`H $oL /N@QHUHHLNu /"/N@UHHNu"_" _N@UHH//N"/ / o "oN@UHHNu!   DDDDD @@  @@ D@ ""@A"H@B @@@@&@ A0C" 1 KR4 KR4 KR"R KRr/ Hy dNPO&@B` KRplR m/ Hy pNPO&@Rpn|A4 м]o "KRpN`pL N^NuNVH0E..G0"J fD/Hy%HxN HxP/ BN JfB`/ / N6POJf`l``J g/Hy%HxN J fT//Hy%HxN HxP/ BNZ Jf'G`Hk/ NPOJf`m +l``J g/+Hy%HxN 6 L N^NuNVH0&nEHy%/ NPOB`D 3Ax\Dg 3Zx_DJg3xHHм `3xHH2xHHg[`01ld Verify pass %ld on stream %01ld Too many bad sectors Usage: Inittape [[-cdefvx] [-p #] [-s #[,#]] devname] ******************** ERROR MAP ******************** Stream Segment Sectors %6ld %8ld %3ld#%lc Do you wish to edit error map (Y/N) ? Command (Add, Delete, End) ? Enter side,segment,sector ? Error in writing VTOC status=%02lx error=%02lx %02lx Error in reading VTOC status=%02lx error=%02lx %02lx ******************** VTOC ******************** Stream Segmen ./bin/input.bin 7442 77777 77777 1145 4007603645 7161 0pL N^NuNV-nHnHx NPON^NuNV/ G'n'n 'n / HxNPO&_N^NuNVH0$n G'n'J'n / HxNpPO. n L N^NuNVH0G$n'n'n'n 'n / HxN(PO.Jf$ L N^NuNVH0$nG'n'n 'J/ Hx-NPOL N^NuNV/ G'n'n 'n / Hx5NPO&_N^NuNVH&nHnHx;NPO.Jg `&pLN^NuNVH0$nG'n'n 'J/ Hx[NPPOL N^NuH0/2/ AH@B@2/Ё/@L.Nu//lD//lDa:Jo lDJolD/_./bin/ipcrm.bin 7442 0 0 6604 4007604047 6630 0./bin/ipcs.bin 7442 0 0 16405 4007604146 6474 0 &+B`JHx // N p0*g" fp0* 2+H//Nd П*` R0+Hn/9 NBHxBN Jl/Hy~HxN HxN>XOHnBBB/N.Jg/NXOL N^NuNV/BBHy HyN.Jg BHy/HxNLHxNXO.N^NuNVH0&n $n/ B/9 N .Jg/N4XOHn/./ /9 N.Jg/NXOL N^NuNVBB/.HxNHxNFXON^NuNVN^NuHop0//NP6N@FNuNVH0| n $p" g JR -fgR -f`J*WDH2fJ,g*/*HxNPO/*HxNPO/* HxNPOHy!DHxNPOR0.HnDL N^NuNVH0EG HxNtXOJ2fJgHy!FHxNPOJ2fJ gHy!XHxNlPOJ2fJgHy!`HxNPPOJ2fJ&gHy!jHxN4POJ2fJ,gHy!zHxNPOHy!HxNPOHx y0HhTHnN ,.B`Hx* *// N p0*g~p0*//90 NPO/p0//90NtPO/p0*/HnHy!N //* p0* 2.H//N П/Hy!HxNHJ2fJg>p0*//90 NPO/p0*/2 hNVHNG/ BNPO.Jf&g"  g  gHH/HxNPO.`~gBJgBB/HxNHxNpXOpLN^NuNVN^NuHop0//NP6N@FNuNVH0&n E%n/ HxN:PO.Jg `pL N^NuNV-nHnHxFNPON^NuH $oL /N@QHUHHLNu /"/N@UHHNu"_" _N@UHH//N"/ / o "oN@UHHNu  @(#)input.c 1.2 (1/22/87)L^1Q68010 XPU 151 Input sou.Nu//lD//lDaJo lD/_.Nua.Nua /o.NuJof&/p0/?@0/?@H@?@ NuH$/r2/0/R@eL?A2/?A"/ /2/2/HABAdS@ԯ/@/BLNu/A2/`NV-nHnHxFNPON^NuH $oL /N@QHUHHLNu /"/N@UHHNu"_" _N@UHH//N"/ / o "oN@UHHNu@20p 4NVH0N$n G/ / NpPO-@Jg ÊҀÊ`` +f`Jf``Hn/NPO.g GJg/Hy(HxN p`zJgJfJf /.NjXO`>JgJfJf /.N|XO` JgJfJf /.NXO`` XJfpp`Hy8HxN POpL N^NuNVH0*.EGJ g(zBHxBN .Jg/NXOHnNXO.Jg/NXON:Hx nHhH/ Nt &+B`JHx. .// NT p0*g" fp0* 2+H//N П*` R0+Hn/92@ ( rNVH0N 8$n G / / N PO-@Jg ÊҀÊ``8Jg`0JVDfJVDfJVDHH,BHxBNN .Jg/N ~XOHy JN XO#0Hy VN XO#0 BBHy0Hy @Nh.Jg BHy @/HxN0HxNXOHy0NXO.Jg/HxNPOHxNXOHy bHxNPOHxN vXOHy zHxNPOJfJfNJJfJfNJfJfNj/90NXOp`Hy |HxNpPOpL N^NuNVH0EG HxNXOJ2fJgHy HxN,POJ2fJ gHyH* JRHH.JgtpA_Dg rZ\DJg м ` .&n`Jf`J\HHfJg`6J+fp'@`Jg n R'pJf` `~`< `pL N^NuNVH0$n &nBBBB  g  g  g  fR` +fR` -fp-@RB A\Dg Z_DJgHHм `HH.p0nr9m0`panrfm Wv``Hx /N` П, Ї(RR`Jfp`P A\Dg Z_DJgHHм `HHrhf,R`Jgp` .g"D`"$ L N^NuNVH0$n G'n'n'n / Hx NPO.Jg `$/90NPO/Hy!HxNJ2fJ gp0*(/Hy!HxN J2fJg/*Hy!HxN J2fJ&g"p0*$/p0*&/Hy!HxNJ2fJ,g*/*HxNTPO/*HxNFPO/* HxN8POHy!HxN@POR0.HnPL N^NuNVH0EG HxNXOJ2fJgHy!HxNPOJ2fJgHy!HxNPOJ2fJ,gHy"HxNPOHy"HxNPOHx y0Hh`HnN ,.B`p0*//90 NPO/p0*//90NPO/Hy!HxNJ2fJ g"p0*&/p0*$/Hy!"HxNtJ2fJgp0*(/Hy!.HxNN J2fJ&g"p0*,/p0**/Hy!6HxN J  //* p0* 2.H//N | П/Hy" HxNJ2fJg>p0*//90 NPO/p0*//90NPO/Hy"@HxNJ2fJgp0*/Hy"JHxNx J2fJ,g/*HxNDPOHy"RHxNLPOR0.HnL N^NuNVHy"T/.N PON^NuNV/ G/ /. NPOp+/p+/p+/Hy"/.N &_N^NuNVH0&n $n/ B/90N L .Jg/NXOHn/./ /90N V.Jg/NXOL N^NuNVH0$n&n B,<` g 2xHH`p-xR ,p nB+ L N^NuNV/ &n@D AD ?"qmsbcopta/dev/amem/etc/passwd/etc/groupIPC Status Report from Usage: Ipcs [-qmsbcopta] CREATOR CGROUP CBYTES QNUM QBYTES LSPID LRPID STIME RTIME CTIME SRrw rw rwq %-7ld%-11ld%-12s%-9s%-7s%-9s%-7s%-8l,d%-5ldl/p+/p+A#8/0Hy#l/.N L N^NuNVN^NuNVH&n~` KRpf ` R o . LN^NuNVH0$n &nBBBB  g  g  g  fR` +fR` -fp-@RB A\Dg Z_DJgHHм `HH.p0nr9m0`panrfm Wv``Hx /Nt П, Ї(RR`Jfp`P A\Dg Z_DJgHHм `HHrhf,R`Jgp` .g"D`"$ L N^NuNVH&n ,.//<QN^.//<QNV,/Hxporl HxNXOBAh,T`pl /NXOBAh,VJgHyiHxNhPO/+/HxNX +HHg6(+ +gNL#k yk"(؁/HyiHxN `HyiHxNPOL N^NuNVH0NH>EnbA#nJB`0+nf +`&S fA" &_N^NuNVBB/.HxN HxN zXON^NuNVN^NuHop0//NP6N@FNuNVhH0BBBHn/.NJfHxHnl/.N JfHxHnlHnlN rnhHn/.tNPOJgVHx/.lNXPO,/NXO$@Jg8Hx NXO&@Jg //.l/ N 7n'J&. `/ N\XO`b/.NVXO/NvXOL N^NuNVH0G$n / S// /.N,Jg `LJg@ S2HH.p WDf r WDfp WDfp WDJf`S` B2pL N^NuNVH0*. &nJg *g ;fp`B%-7l,d%-6ld%-6ld CREATOR CGROUP NATTCH SEGSZ CPID LPID ATIME DTIME CTIME D rw rw rwm %-7ld%-11ld%-12s%-9s%-7s%-9s%-7s%-7ld%-8l,d%-6ld%-6ld CREATOR CGROUP NSEMS OTIME ra ra ras %-7ld%-11ld%-12s%-9s%-7s%-9s%-7s%-8l,d T ID KEY MODE OWNER GROUP %02ld:%02ld:%02ld @(#)ipcs.c 1.2 (12/24/86)/h1Q68010 XPU 151 Ipcs source 1.2 Copyright (c) 1986 Cromemc@/HxN ,/HxN. f V.<m`/HxmN ܀/HxmN. *A#p0XހCp1Xd Rr1GVp l RE м<LN^NuNVN^NuNVH0..E#por` X"¼Ё".JgD&R&k* n. Pn Г&@&` R!k fBA `<$&kf м,/N&XO&@Jfp`& X/N6XO`L N^NuNVB/.HnBNJgp` .N^NuNVH0$nYJ#g y#&h #o##` #l o ##&k` y#!J%K&y# Гf k 0(|.<p,<r~NFNFNJNA 0cPOpk fr `bNNlHyk.HykHxN  N#/ /.NPONNNNLN|NJnNVDf JnFVDHH&_N^NuNVN^NuNV/ NLGq"/ Hyj8 yk Hh N z Hyj>/ N9PO#qJf / Hyj@HydN:f HxNIXO&_N^NuNVNLBHxHyoNG #p Jl$HyoHyj`HydN: HxNHXON^NuNV/ NLDGp HyjN2&XOJjDaJo lD/_.Nua.Nua /o.NuJof&/p0/?@0/?@H@?@ NuH$/r2/0/R@eL?A2/?A"/ /2/2/HABAdS@ԯ/@/BLNu/A2/`NV-nHnHxFNPON^NuH $oL /N@QHUHHLNu /"/N@UHHNu"_" _N@UHH//N"/ / o "oN@UHHNu@A @ @@@ @@@@@@ Ai#nVBn^p#nZr#nR"yev/)NXOJg HxNXO#n^nFBAi,#nVBn^p#nZr#nR"yev/)NXOJg HxNjXO#n^nNGiFJnNg/9nN/ HxN$ `/9nN/ HxN GihJnFg/9nF/ HxN `/9nF/ HxN L N^NuNVH0NG&n#nrpnZf+HH¼g``+HHnZf`Rn^JnRg/9nVHyiHxN^ BnRpnbf HxN^XO/+NjXO.p oEiRnb` poEiTnb` EiVnb/+/ HxN L N^NuNVNF2Hyi Ю,g  g  g  g  fR`$Kg :gR` l$ + g + g + g + fS`S FB E R" ! // /N g :gR`gR```b E B L N^NuNVH0&n g .&$K&G` L N^NuNVH0| n $p" g JR -fgR -f`J*WDHH* JRHH.JgtpA_Dg rZ\DJg м ` .&n`Jf`J\HHfJg`6J+fp'@`Jg n R'pJf` `~`< `pL N^NuNVH0GE/ N.NXOp*/p*/p/pмo, Inc. #############%3s-%02ld-%04ld %02ld:%02ld:%02ld//::JanFebMarAprMayJunJulAugSepOctNovDec  I0ѓ k'h`&k Гf k ѓ k'h`##` ##%JL N^NuNVN^Nu"/g@ o/4|gSH4H@04<A` Qd`QNu$/ gL o"o02 |f|g `&|g SrB`"Qd$`QdNu$/ g o"o`QNu"/g8 o4|gS4<A` Qd`QNuNVH0$n G'n'n'n / Hx NfPO.Jg `$pL N^NuNV-nHnHx N4PON^NuNV/ G'n'n 'n / HxNPO&_N^NuNVH0$n G'n'J'n fB/9q/N4b /N48XO/NEXO&_N^NuNVNKHyjtHypN8PO#qJf$HypHyjvHydN9~ HxNH&XON^NuNVNK/9qN7xXON^NuNV/ NK&n B/./9p N3 /./ /9p N3 &_N^NuNV/ NKX&n B/./9p N3 /./ /9p N3 JlHyjHydN8POHxNGxXO&_N^NuNVHNJGj.</NB^XO&Jf/HxNM.`/HxNL,pmHyjHydN8fPOHxNGXO'G/ N0BXOJjg&ppg Г///HyjHxNLN^NuNVN^NuNVHNJNGk~Jjg Jjg` yk /.NPOBnbN^NuNV/ NF&n g/a. ynJN.aXO&_N^NuNVH0NEEHyiHxNPO&yn `$/+ /+HyiHxN/+N0XO&S fJjf/9nvHyiHxN L N^NuNVHNEj..GHyiHxNPO gHyiHxNPO gHyiHxNPO gHyiHxNPO gHyiHxNPO gHyiHxNPO @gHyiHxNPOHyiHxNPOLN^NuNVHND&n Jjg`6B` /3HyiHxN& RmHyjHxN POLN^NuNVHNDJ(.&.&n BBB .gSgSg S(HHg S(`J`/ NXO S!n Sp@ Sn S1n Sn S(HH f SB(L N^NuNV/ N5GpRqHx/ N4PO/ NXOJg`/ NXO&_N^NuNV/ N5tGn~ 9qko#kp+ f`>pjf4r+#j$ T B$<Đ#nn#k nj#pnf&_N^NuNV/ N4HxHypNPON&@ yj #j&_N^NuNV/ N4HxHypNRPON&@ yk #k&_N^NuNVN4p9n#jr9n#jN^NuNVH0N4j$nHxNXO#nr/ N.XOR/NXO&@/ / N>PO ynr!K yHH/ S0(H/ S(HH/N &_N^NuNVH0N?&yk`@ +f4$k`* * f.*` G (f `. G.Jf$R f&S fHyh\HxNFPOHxN;XOL N^NuNVN?~Hyq"HyqHyh~HxNHxN;XON^NuNVN^NuNVH0N?>$n Gk p#r*r#k 9r*lb/ /.NPOJgPJk flNfp#pJgN>`N/9qN*XON^NuNVH0N>4*.$n kNPON\N^NuNV/N0An~ P"@ <. gp9n//9kNpPO߹n S&JfJnzgNNl&n(`NB S&JfN` Rp gN`NN JfJnzg\Jn8mnB/9n0/9n4/9n8HyeN/9n,/9n0/9n4/9n8HyeN/9n,/9n0/9n4/9n8HyeNJnmnB/9n /9n/9nHyfNd/9n/9n /9n/9nHyfN>/9n/9n /9n/9nHyfNN`NzNJfJn8m&/9n,/9n0/9n4/9n8Hyg Sfg~` ~|`|`zJg.Jjf&/.,/.(/.$/. /././// N18$Jg,/.,/.(/.$/. /././// HydN1l(Jg4Jjf,/.,/.(/.$/. /././// /9qN14(LN^NuNVN^NuNVH0NC^&n . An~EB` KR"JRR 9o~ nBL N^NuNVH0NC$n&J`Rf L N^NuNVH0NB&n$n `RRfL N^NuNVH0NB&n$n `RRf L N^NuNVH0NB$n&n/ / NPO/ NXO&@Jg/. / N'*POJfBL N^NuNVH0NBZ$n&n/ / NvPO&@/ N`XOJf /. / N\POLnrB(/9nrN0XOL N^NuNV/ N4Gk yk S#k"SRk #yk  SBBk&_N^NuNV/ N3HypNXOм/N XO&@Hk HypNPOB &_N^NuNVN^NuNV/ N3|Gk p#k &k`0 S#kJgNPp#pN/9qNXO S&Jf&_N^NuNVN3$Nrgnp9n~k^ @ nXH0;N &,28>DJ`4N`.N`(N`"N`N`NZ`Nz` N`N*`N^NuNVN2NPrg@p9n~k0 @ n*H0;N ``N`N^NuNVN2JJkgRp yk 9pGr*BBj  r -f (2 R @g Z_Dg A\DJg HHм ` HH H@m0k @ nH0;N:R.Ft @ gW@fxgp#j`hp#j`\p#nz`PHxo/NPOJg\p#j~HyoHyg"R/2N HypHygHyoN HyoHygHyoN `Hxs/N POJg6p#j~HypHyg"R/2N N#k N`Hxy/NPOJg p#j~"R/2NXO#p`bHxd/NPOJg p#j~"R/2NXO#p`.Hxx/NnPOJg(rg .tf&p8-@` @g~B`p ."ЁAr.JgTJjf 20yn@f@ Г".$҂Ar.-@tg .rf&p(Ю-@`Rpn&p:-@  ggf*g 9nBU-@` 9nBY-@` 9nB]-@ g"pr t8Į튀-@-|`p?-@HxHn/.HyjNp.r.ɀ-@".Fî .ҁn".AHxHn/.HyjN(` g ѓ` ѓk &@"&Jgpg/HyfHxN HxHn/9nBHyjNN &,28>DJLNPRT`:N`4Nf`.N@`(Nx`$N`N`NF``` ` ```NL`N^NuNVH0N7$nBq/ NXOм/NXO&@Hk / NPOBRp'ypBJkg yk ` yk !K#kBkL N^NuNVH0N7@En~p*f`HxHypNPOHypNXOм/NzXO&@HkHypNPOBp*'@ T @ <'@ \ @p0'@ Jkg yk ` yk!K#kL N^NuNVN6HxHypNPOAn~ X"@/p9n//9p/9k HypN N^NuNVH0N6B$nGnr/ NzXO&JfNJnm&/9n/9n /9n/9nHyfNpjf JjfHyf"HxN~POBnv`./9j/9nf/9njN $ R 9nnШ#nv#nq/9gj/9jNPOѹnNpJjfN.NL N^NuNVH0N'PGn$&n(`" S/( ykHhN POJf` $S S&JfJfLHxNXO& g$`#n( SB S"yk!i  S"yk-HA"n#H SB `* S"yk ( g S/(Hyf8HxNP S-H S-HHx"yk/)NPO n l S ( `Hx yk/(NPO n!@ L N^NuNVH0N&>..&yn `  N^NuNVH0NB&n$n/ / N6PO$@/ N XO&@Jg$K/. / NPOL N^NuNVH0NA&n$K` /g ^f R$@Rf .fR`&J` .f$KRf L N^NuNV/ NA/.N8XO&@Jg `Hyh4HydN/POHxN=XO&_N^NuNVHNABGn~Hx/ /9qNh .rgJfp`JNHxN=vXOp+U,/Hk/9qN, .gN~HxN=DXO T#o~LN^NuNVH0N@$n &nB`8SJm R @HH`/ N)XO,rf` JRRm L N^NuNVN@^HyhDHxNPOHxN ,//++ HH/N .g + p`&'|pLN^NuNV S&Jg S$Jg`6` yk #k Jg$ yk &` S$Jg` S&Jf`L N^NuNV/ NGe 9j@ 9j@p@r3A'yn'ynv Hx / BHyjN&_N^NuNVH0NpGr.EnrB` "ЁJgzBs/3NXO$JgH RJ(g&N#k yk,("$҂t7`B "Ё R"Ҩ '`/HyfHxNڎ HxN@XORpnnL N^NuNVN^NuNVH0NGnEm#evm yev&#m yevJf yevX#np`t//.NPO.Jg`Jl, S$Jf S#np`J RJ(g #m# @ Am Zn H@m>@mgBY@gU@g8W@f\g0@ kR @nJH0;N|||@cf.g( .X @,-FA&B. df^ fS"Cr8,<334J]"DAg D,S C/Hx Np0П/Hx N,f.gS Cr-` uf,S C/.Hx Np0ПA/Hx N Jf`` of S Cpм0A  f`: xf.S Cpм0 C 9o C'A  f`S CA ".-AJfH.g .0f$R"BHH// /N .SJo.HH// /N `A o R"@HH// /N ` .m &B, &J` FBL N^NuNVH0N$n&j`pf / / NPO&S fL N^NuNVH0N$n . r , < .//.NPO&@`& mBR//.NPO&@xSRRJfL N^NuNVH0Nd$n . r , < .//.NVPO&@p'@`0 m'G BR//.N0PO&@p'@xSRRJfʾ o'G L N^NuNVH0N,. $nB&jJf'F/ / NJPOf`$Jf/ / NPO'F/ / N&PO`. &S`Jg G &%K L N^NuNVH0Nl&n $nHxHkNjPOHxHk +r / j N '@ p'@L nHx./ /N 0.RnHroJgSHx0/ /N ` SJg.po6hHH// /N `Hx0/ /N R` .SJo.HH// /N ``` HH// /N ` HH// /N `HJg R @BL N^NuNVH0N P&nEcg@S J m *R @"KRHH`Hj KRHH/N:PO`HxNdXOL N^NuNV/ N&n . S Jg KRB`&_N^NuNVH0N# mG EmB` JX"KX RpnL N^NuNVH0N..Ee .R @g %f n -WDHH-AJgR n 0f Rp0@`p @B`(Hx /.N .R @HHҟ0-A n 0m n 9o n .WDHH-@Jg@RB`$Hx /Nb .R @HHҟ0( n 0m n 9o n lfR .Rf RB( ymG SB(`F&mJo R"ym!Q ym ` R"ym  ym!R R"ymB)B( ym f ym!S` ym L N^NuNVH0N&n$n /*/ N6POL N^NuNVH0Nl&n$n /*/+N POL N^NuNVH0NB&n$n `Jfp`RR Z_Dg A\DJgHHм `HH-@ Z_Dg A\DJgHHм `HH".g Z_Dg A\DJgHHм `HH-@ Z_Dg A\DJgHHм `HH". L N^NuNVN^NuNVH0NN*. E&P E Ш. E!K м$@gHx-/ /N .HH// /N Hx./ /N |`,po6hHH// /N `Hx0/ /N RSnJnfSnHxe/ /N 0.HlHx-/ /N 0.HD=@`Hx+/ /N 0.H/HxdN r0ҟ// /N A0HdH@00.H/Hx N jr0ҟ// /N 0.H/Hx N >r0ҟ// /N `H gfJo0.H"ҀS 60fS`.HH"ҀR$.-B2.HoH`SJf" .SJo.HH// /N `.gHx-/ /N 0.HnHx0/ /N B`,po6hHH// /N `Hx0/ /N R0.SnH BNuH o $<v N@d( @ f$<v N@e LNuNpLNu/ /g:NBt&xN@# / N."t&xN@# /N"t&xN@#" LNupVVVTONuH o$/ &/N@d NJpLNu LNuH"/ o &/SN@d NBLNuJ00g 0 0f 0 0f 0SB00R LNuH"/$/&/ jJgDDN@d NpLNuN@ LNuH o$/ BN@ d NpLNu LNuH"/ o N@d NtpLNu LNuH"/&/ o N@d @g NDpLNupLNu LNuH"/&/ o N@d NkgP[SEngBEd RE Eg0/A$L.NuJffg"<`B`"<`oHL$UUŰcBCEHN"JGf(gJFf `0 FgpFDGQGmfJf` ^GkQJkցՀdRF|m`JdFED@NNMH ,L..NuN"`(fFfJj$<B`$<B`////////N/_/_B B////////abd  m4L /WNu////////a.d o /o /oL /WNuHL(ȀkBCf (g< g&f / fApp`ATpN@//NNLN( XmNuA\pNNN,Range error String range error Floating point NAN Floating point infinity Stack overflow "0//J@m @4o <B`0BB`*2AA.I/ / HHgA/ / N ^ " _Nu?@$@Y@@@È@jA.AcAׄAeB_ B7HvBmB0@BּC k&4CAy7?CAy7FnI1sM8O?PQ_SubسcW0$fZwH02]ԀW8ua&%odyER0xg$k%LnqJRgq24zu<Jf Jj4XO`Gfl<$HBNFHB b $<JjTB`BBXO`xBփՂ\ ǖ[j ցՀ JD]Nu////////aL/_ NuHL$*xa8SGGo <SFaF  `"JDoA/ / ?NHN*A nC LN^ _ NNVH0&n$nA/ / NZJgA/ / BBNf]DgP/ / W BFAC / / B/<@$N0oJ~A/ / ?NHNo"GA/ / ?NHN A ` H>JGfA/ / BBNgP/ / B/JGfn noz`:.A/ / B/<@?NHNNtA / fJg ]XON _ XON$ $@BH HB"B I @@ $DD$@D $ D@@   @HDH@ @$$    A@@@A"$ D@%(@"$B$"@ @ @  @ $  pLNu LNuH/NF NuH$o@L"/DN@LdpNuBNu oN@dNBNu /NuN m //NtNuBNuB/N Nu//NNu&/N@F/B// Hz0Hz&"OBBN@HTgBN@EB&Nushell-c$/ oN@@TNu&_& O4`$"X$IBARAJf0R@@$OSA`QQ C0"OB`/ BATAAQ$X^/?<a>$O^/?<a0"O^/?<a" O/Bg/ C?SW// / HzNNuBCN@F o/ C\!I"_B(B(||1|Bh 1o 1|UU|B(B(B(BBB( _\ON _"/R -Ҁ$ki?|"`>?|"`6i?|"`,?| "`$ki?|"`?|"`i?| "`?|"㊰dB c?|"`f?|"L/_ NwH / "/BCBD@ARSDoHRRSCoVR蘘C6HA4B@䀁HHHBЂDN6/@ L?.Nuf SDbRD`g*Jg`$gJfB`Jg SCdRC`Jg <`eJg@`p`HL$*グcBCNF:,G|gJGgHL:/B:/ օӇ:/ օӇ:օӇ:/ ԅч: ԅчH@: ҅GH@6HCBAHAւчЁ$FN Os`A/ / N =@ Go"P/ / H/NNB/<@ÈN v D@m(0.H H@=@"Ct0nJngB.0.H =@SCJClXDSG Glv R@=n>` p0pRGino.gBFB n 0`bA/ / N rJgp?=@`A/ / N Jgp-=@`p+=@=n~` pRGino n BP n-WDL N^ _NoHL UUðcACBBDfJgvJffҀ`j`f<< gf<D FmQFf쨴fҀd$RE|m`ZD $   $D@ @@@ $"  $! $ $$!$$$$I$DI@ @@@@" @ @$$H@D"A   @ BD@JA @$@$$I@  @@@@n+ANuApNDN?NuBNu.NuAO /H@aH@XaXaA0par.Nu?a 0a0Nu@ o^<0Nuaddress $000000 Nu/0/ o m.on( /W\Nu/ / mn /W NuAp N//NZN?/@on 0/WXNuApN//N*N?0/@ @g0Nu /gAp`ApN//NN?0/@ @g0Nu /H ,L..Nu*Gg<<N`.gSFjRF`J$<`BB`//oH"/N0a"HLNuHLaN `HLaN6/AL.NuH~LafNpN L~..NuLH>aFNP`LH>a4N|aL|..Nu o"_$.H0YO/La N2L Nu$<&HCĀ(f<Jg,<`&HBJ|f4<`<Jg<`SB<B2NuLH0HN*aH _POL N m `B>BFCa@ar, AKNux ,<.̂(ȃ⊄(΀ȁ∀NuJf F m F BJgk [ZNuNVH6. B nl8.`x=D|`$Hx /N n0`HHП*0RFino/N. R@=n<`,//`6A/ / B/<@$N"n1pH|0H/NN RGinoJDl^ Dl4A/ / pD?NHN /<7/p0+"/p0+"/Hy!HxN`/+Hy"HxN L N^NuNVH0&nEfp+VDHHA" 0HH/Hy""HxN p+/NXOp+/NXOp+/NXOL N^NuNV/.. gpa`p-/ gpw`p-/ gpe`p-/./bin/ls.bin 7442 77777 77777 21634 4007605100 6451 0/ S//N`L N^NuNVH0&n,. $s І. nZ l R/3 /3 nNPOJlR /3/ nNPOJl "',`` '`L N^NuNVH0EBBHn/.N h.JgB/./HxN~`/ Hx/.N pl"`p"/NXO&@Jg`JgRHn// /.N h.JgBB/HxN/ N"XO` n -H// N@PO n ` n BB`BBHxHxN /.N XO L N^NuNVH0(. &n$K* Є/Hx N 2( ÊҀÊB SJgR0*Hg>Hx/ NPO.rm`Rckk Cannot allocate stream buffer Cannot allocate stream buffer @(#)vmm.c 1.28 (10/6/86)eB$F` R/(/.NPOSXJf` //NPO/N<.N6XOL N^NuNVnH0$n g,/. Hy / A&H/NZPO/NRPO/NJPO`&n HnrHx / N .JgB/ /HxNp` n-HnHnrN,XO nn pL N^NuNVH0&n $n f/+/*NPO.` dp`p. < Jg D` L N^NuNV|H0.. Epx JgHn//.N &@Jf` +$ѹ V +ѹ Zp Jg /Hy HxN / NXOHy!HxNPOHk(N:.NXOHy!HxNPOHy!HxNPOHk.NXOp0+/NHXOHy!*HxNPOp0+/Nown symbol(s) %s %-12s%-24s%-36s Address Size Attributes %06lx %06lx Starting address: %06lx RWECSU %s J@(#)linkio.c 1.28 (10/6/86)j.o68rUnable to open input file "%s" Cannot create "%s" wCannot create "%s" Disk I/O error Out of memory VMM pages = %d (%08lx - %08lx) jkk1Q68010 XPU 151 Link68 source 1.29  gpr`p-/Hy"&HxN".N^NuNV/ &y ^`0+n f`&S f g/+Hy"4HxN `p0. /Hy"HxNPOpL N^NuNVH0EGHnBBN: <.B/ /9 `N .Jg/9 `/HxN p`tHnHx0/ /Nb.Jf k*f``/NXOJgHy dHxNTPOp`0HxHkHy0NP nC0 n p0+( pL N^NuNVH0GEHy NXO.Jlp`/.Hy Hy /N/N XOHy /NPOHnHxBNP pfHy HxNPO/ Hx/ BNf,Jf/ // /N,Jg``Jgpg/HxNfPO/NXOp` L N^NuNVtH0E&n/ Hy HnN@@ @@BB  "IHA ?#abdeilmrst# #$#(#,#0#4#8#<#@#D#H#L#P/etc/passPOBB/N /N XOHxBN,PO`Hy!HxNPO/N RXO L N^NuNVH0G$n/ Hy!HxN HnHxP/ BN Jg A\Dg Z_DJgHHм `HH yWDf nWDJg yWDHHL N^NuNV/ &n/ NzXOJgp`/ Hy!HxN p&_N^NuNVN^NuHop0//NP6N@FNuNV/ NN&@Jg +f``N &_N^NuNVH0NN.Jgv G&P$n` Jf`fRR A\Dg Z_DJgHHм `HH-@ A\Dg Z_DJgHHм `HH".g`NJ L N^L N^NuNVH&n~` KRpf ` R o . LN^NuNVH0&n .ËҀË$KB .SJg&S/. Hx Nr0ҟA /Hx Nj ` L N^NuNVH0$n &nBBBB  g  g  g  fR` +fR` -fp-@RB A\Dg Z_DJgHHм `HH.p0nr9m0`panrfm Wv``Hx /Nx П, Ї(RR`Jfp`P A\Dg Z_DJgHHм `HHrhf,R`Jgp` .g"D`"$ L N^NuNVH0&n$n JRgR` L N^NuNVH&np<,./bin/mail.bin 7442 0 0 17141 4012165714 6455 0 L N^NuNVH0G$n'n'n 'J/ Hx NPO.Jg `P . SkF n>H0;N$$$$$$$$$*6666**$$ ` + ሀ$pL N^NuNVH0G$n'n'n 'J/ Hx!N@PO.Jg `P . SkF n>H0;N$$$$$$$$$*6666**$$ ` + ሀ$pL N^NuNVH0&nE/ Hx0NPO.Jg `j jjpL N^NuNVH0$n G'n'R'n 'n/ HxPNbPO.Jg `$pL N^NuH0/2/ AH@B@2/Ё/@L.Nu//lD//lDPO/NPOHxBN:POHxHxHn|HnN.HxBNPOJg$/HxNPO/ Hy!HxN `BB/.NV HntHx/ /.Np.Jf Hnt/.t/ /.|N.Jg``JgpfB` /HxNfPO/.|NXOJ g/ Hy!HxN* / /. NPO L N^NuNVDH0GEB/ /9!(N .Jg/9!(/HxN p`HnHx0/ /N.JfHj/. N POJf``/NXOpfr `bJg/HxNPOp`N/ Hy!,HnDN PO/N POHx/ HnDN| Jf/.Hy!2/N4 /NXOpL N^NuNVlH0wd/etc/group Directory: %s .Usage: Ls [-abdeilmrst] [file-list] /%s %6lu %s %-28s created: modified: accessed: links: %-5lu dumped: inode: %-5lu /%11l,u D%3lu %7lu:%-4luB%3lu %7lu:%-4luC%3lu %11l,u %3lu %11l,u directory block device %lu:%lu character device %lu:%lu %11l,u S%lc%lc%lc%lc%lc %-11s owner:%-5lu %-12s group: %-5lu %3s-%02ld-%04ld %02ld:%02ld:%02ld %3s-%02ld %02ld:%02ld %5ld NuNVH0EJ"dl BHy"dHy"hN  Jgp`/ HxHy0/9"dN (Jgp` A0B0G0B`  g  g  g  fR` -@g :VDJg `p".-g4 :g.  WDf  WDf  WDf  WDJfR` :f KRB`g KRBg KR :g`RpnVJVDgJVDJg&nB`  g  g  g  fR`Jf`x A1!g4 ,g.  WDf  WDf  WDf  WDJfR` ,f KRB`g KRBg KR ,g`Rp?nh A1B#2#2Hy2p+.rc  S`WHxm/N П"Ёr+ЁA#r0x*/<Q/Nnp+Пr+t+HxHxNDPOpL N^NuNVN^NuHop0//NP6N@FNuNVH0| n $p" g JR -fD/_.Nu//lD//lDaJo lD/_.Nua.Nua /o.NuJof&/p0/?@0/?@H@?@ NuH$/r2/0/R@eL?A2/?A"/ /2/2/HABAdS@ԯ/@/BLNu/A2/`H $oL /N@QHUHHLNu /"/N@UHHNu"_" _N@UHH//N"/ / o "oN@UHHNu" @ @  @@B@"/ / o "oN@UHHNu@  rcIllegal device type Illegal device number Usage: Makdev [-c] pathname b|c majornum minornum @(#)makdev.c 1.2 (1/22/87)1Q68010 XPU 151 Makdev source 1.2 Copyright (c) 1986 Cromemco, Inc. g KRBg KR :g`RpnPJVDgJVDgJ VDgJVDJg#3 #3$Hy3(/*NPOHy3,/* NPO#30#34#38A3 L N^NuNVBB/9"tN N^NuNV/9"tNXOp#"tN^NuNVN^NuNVH0| n $p" g JR -fgR -f`J*WDHH* JRHH.JgtpA_Dg rZ\DJg м ` .&n`Jf`J\HHfJg`6J+fp'@`Jg n R'pJf` `~`< `pL N^NuNVH0GE/ N.N*XOp*/p*/p/pcCannot create temp file *I0<4H0$n G'n'n'n / HxNPO.Jg `$pL N^NuNVH0$n G'n'n'n / Hx NjPO.Jg `$pL N^NuNV-nHnHx N8PON^NuNV-nHnHx NPON^NuNV/ G'n'n 'n / HxNPO&_N^NuNVH0$n G'n'J'n / HxNPO. n L N^NuNVH0$n G'n'J'n / HxN|PO. n L N^NuNVH0$n G'n'J'n / HxNH0;gR -f`J*WDHH* JRHH.JgtpA_Dg rZ\DJg м ` .&n`Jf`J\HHfJg`6J+fp'@`Jg n R'pJf` `~`< `pL N^NuNV/ &nHH g\` +&_N^NuNVH0$n &nBBBB  g  g  g  fR` +fR` -fp-@RB A\Dg Z_DJgHHм `HH.p0nr9m0`panrfm Wv``Hx /N П, Ї(RR`Jfp`P A\Dg Z_DJgHHм `HHrhf,R`Jgp` .g"D`"$ L N^A@   "@@"$@  03!agnvyGroup "%s" not found Usage: Mail [-agnvy] [name ...] !Cannot determine who I am --------------------------------------------------------------/tmp/mail#####.###%s From %s, Enter mail: /usr/mail/Mail not sent to %./bin/make.bin 7442 77777 77777 14353 4007605412 6756 0мl/p+/p+A"/0Hy"/.N L N^NuNVN^NuNVH0$n &n` Jfp`RRgHHHHL N^NuNVH0$n &nBBBB  g  g  g  fR` +fR` -fp-@RB A\Dg Z_DJgHHм `HH.p0nr9m0`panrfm Wv``Hx /N П, Ї(RR`Jfp`P A\Dg Z_DJgHHм `HHrhf,R`Jgp` .g"D`"$ L N^NuNVdH0EHntNXOB/./ NPO(&D` .f`S o`* #f"/.tHx Np0ПAt./bin/makdev.bin 7400 77777 77777 3654 4007605206 7265 0N$$$$$$$$$*6666**$$ ` + ሀ$pL N^NuNVH0$nG'n'J'n 'n 'n/ Hx#N`POL N^NuNVH0G$n'n'n / Hx(N0PO.Jg `$ pL N^NuNVH0&nE/ Hx0NPO.Jg `j jjpL N^NuNVH0E&n/ Hx2NPO.Jg `j jpL N^NuNV/ G'n'n 'n / Hx5NhPO&_N^NuNVH&nHnHx:NFPO.Jg `&pLN^NuH0/2/ AH@B@2/Ё/@L.Nu//lD//lDa:Jo lDJolNuNVH0$nG'J'n . '@ < '@/ BNpPOL N^NuNV/ G'n  .'@ <'@/ HxN4PO&_N^NuH0/2/ AH@B@2/Ё/@L.Nu//lD//lDa:Jo lDJolD/_.Nu//lD//lDaJo lD/_.Nua.Nua /o.NuJof&/p0/?@0/?@H@?@ NuH$/r2/0/R@eL?A2/?A"/ /2/2/HABAdS@ԯ/@/BLNu/A2/`H $oL /N@QHUHHLNu /"/N@UHHNu"_" _N@UHH//N 2@TLNVH0Nd&n B/ Hy N PO,Jg#  ËҀË# ``Jf`zHy /HnN PO/N POHnHy &HnN $@Jg(HnN`.NRXOJg~HnNn.NXO`HnHy (HxN ~ `Hy :HxNPOpL N^NuNVH0G0E p-@$vBJf/.HxHnN H JglHxHnHnNf Hxv/ N POJfHxd/ N |POJgHnHy fHxN Hx/ HnN *l~`Jf`t/ NXO,lJ$fHxf/ N POJglHxd/ N POJgHy jHxNQd`QNuNV/ &n-KHnHxNDPO&_N^NuNV/ &n-KHnHxN PO&_N^NuNVH0$n G'n'n'n / HxNPO.Jg `$pL N^NuNVH0$n G'n'n'n / Hx NPO.Jg `$pL N^NuNV-nHnHx NpPON^NuNVH0$n G'n'J'n / HxN@PO. n L N^NuNVH0$n G'n'J'n / HxNPO. n L N^NuNVH0&n E%n/ HxNPO.Jg `pL N^NuNVH0G$n'n'n 'J/ Hx NPO.Jg RR A\Dg Z_DJgHHм `HH-@ A\Dg Z_DJgHHм `HH".gJWDg a\Dg z_DJgp`pL N^NuNVH0&n $nJgJfp`B`HnHx /3N  *Jg,pfr `B /3/HxN p`HxdHy NPOJgHn /3NPOB`~HnHx /2N *JgB /2/HxN pp`XHxdHy NPOJgHn /2NdPOHxHnHnN Jop`Rm|RmpL N^NuNV/ &nJg KX/N~XO`&_N^NuNVH0$n&n / Hy l'dfv.makrCannot open "%s" Usage: Make [-dfv] makefile arg1 arg2 ... %s Make -d: Do execute preceding line DIRectoryMake -d: Do not execute preceding line !l!r!v!x!|!!!!!!!!!!Make -d: File "%-24s" modified on %02.2ld:%02.2ld:%02.2ld %s %02.2ld, %4ld shell-cJanFebMarAprMayJunJulAugSepOctNovDec1Q68010 HxNpL N^NuNVH0| n $p" g JR -fgR -f`J*WDHH* JRHH.JgtpA_Dg rZ\DJg м ` .&n`Jf`J\HHfJg`6J+fp'@`Jg n R'pJf` `~`< `pL N^NuNV/ &nHH g\` +&_N^NuNVH0&n $n .SJggrt `RR`pL N^NuNVH0&n$n JRgR` L N^NuNVH0..E"(por` X"¼Ё".JgD&R&k* n. Pn Г&@&` R!k fBA `<$&kf м2@ NVH0N&n EB/ Hy N PO-@Jg ËҀË``HxrHy N PO#0Hy0Hy0HxsN Jg`PHy0Hy0HxbN Jg`4Hy0Hy0 HxiN Jg`Jg KX/N(XO` `Hy "HxNPOpL N^NuNVtH0GxE0/.HnNPOHxHx/ HnN .JgBHn/HxNn`/ Hx/N  .JgBB/HxNB`pVDHH.JgHnHy VHxN `/ Hx/N pfBB~)/HxN`v/ B/N p.JgHy nHxPO/Hy NPOJg,Jg&/+N XO.JgB/+/HxN` HnNbXO.` Hxd/ N POJgHy HxNJPOv`RHH0. l$ y  $p` R @RSgJf`Jg R @SRf EBL N^NuNVlH0*. &nS  g  g  g  fR`Bg %g־l :fE JRp:|R`JBE`RRRg6 %g0  WDf  WDf  WDf  WDJf :fBR E`P . SkF n>H0;N$$$$$$$$$*6666**$$ ` + ሀ$pL N^NuNVH&nHnHx:NPO.Jg `&pLN^NuNVH0G..$n Joplp"`p'GA f SA","0` "'A/ Hx@NPO,Jg `2 n-H SA","+fCV ` + n pL N^NuNV/ G'n'n / HxAN.PO&_N^NuNVH0$n G'n'R / HxENPO.Jg `$ n  n pL N^NuNVH0$nG'J'n'n/ HxHNPO.Jg ` n pL N^NuNVH0$n G'n!HxN p+/p+/p+/Hy!@HxN pмl/p+/p+A /0Hy!ZHxN HL N^NuNVN^NuHop0//NP6N@FNuNVH&nJk gP/ N&XO.0+ HgHx/+N8POBBk pH'@2+H/NXOJgp` `pLN^NuNVB/. HnHxN N^NuNVH0$n&nHx/ NPO n H@gF@g[@fZgBBHn/ N>.p7@ `>BHxHn/ N.p7@ ` BHxHn/ N.p7@ `~JgBk p` 7nB L N^NuNVH0&n0+ Hfp`0+ XPU 151 Make source 1.5 Copyright (c) 1986 Cromemco, Inc. 68:<>@BDUnexpected signal number %ld I0,/N&XO&@Jfp`& X/N6XO`L N^NuNVB/.HnBNJgp` .N^NuNVH0$nYJ"(g y"(&h "(o#"(` "(l o #"(&k` y"(!J%K&y"( Гf k ѓ k'h`&k Гf k ѓ k'h`#"(` #"(%JL N^NuNVN^Nu"/g@ o/4|gSH4H@04<A` Qd`QNu$/ gL o"o02 |f|g `&|g SrB`"Qd$`QdNu$/ g o"o`QNu"/g8 o4|gS4<A` NPO`LN,JfHy HxNPO~`./NDXO.Jf J0fN<.fN.JfN ./N XOJgp`pL N^NuNVH0E&nHxHy HkN JfbHy HxNPOHnHx/ BN Jgp` A\Dg Z_DJgHHм `HHrygp`vHx/ N POHnN XO6HxHy HkN  NfJfNJfNJgp`*p0+r2+ /HxN dП#2 # 2$r L N^NuNVH0E&JHx/ N POp6.92$S2 eNp0rPb2/ /NPOJg/Hy HxN p`4Hx/ NPO0RS'`HxB/ Hy Hl/N vXO".l np!Jf /NXOp`BHn E R/0N PO  g  g  g  fR`` E B L N^NuNVH&nB` S :f ` RXJfpLN^NuNVH0EG B(#0B`\ HvHx/3N rf $3S婈`HnAh/ /3N p"$3S娊Rpn# /// Hy Nd,fHnHn/ BN ,p.gJgBB/HxNV`,.B`Hn /6/3N RpnJ0g/ N ./90N nPO L N^NuNVJ0f#0N^NuNVH0$n &n`Jfp`'R'n 'n/ HxPN^PO.Jg `$pL N^NuNVN^NuBH />A/NXLDXNuaaaaaaaaH $oL /N@QHUHHLNu /"/N@UHHNu"_" _N@UHH//N"/ / o "oN@UHHNu@ @ "B@@@D ADHgp`tJfp`j$k`20+Hr.gBB0+H/HxN p`< .ÊҀÊHn // 0+H/N7@J@f&'|pL N^NuNVH0$n,.&J~XS J o8 FSJm F R @p`/N@XO.rgp g KR`BpWDg" WDJgp` L N^NuNVH0&nER0+ Hfp`0+ Hg./ 0+H/NFPO7@J@g0+Hr.g`~` `Jf"HxNXO'@Jgk `p7@`N/ Hx&/+0+H/Nd7@J@g0+Hr.g`Jg``S'R R @p`,k 0+HrgBB0+H/./bin/makfs.bin 7400 77777 77777 12232 4007605540 7130 0 0H0;N$$$$$$$$$*6666**$$ ` + ሀ$pL N^NuNVH0&n $n-J-KHnHx$NPOL N^NuH $oL /N@QHUHHLNu /"/N@UHHNu"_" _N@UHH//N"/ / o "oN@UHHNu @   fv/Usage: Maklink [-fv] source-file destination-file Maklink [-fv] file-list destination directory %s @(#sbiUsage: Makfs [-r] [-s #] [-b #] [-i #] device ... Not a block device: %s Cannot make file system on mounted device Cannot read super blockcromixExisting file system will be destroyed. Continue (Y/N) ? Cannot write free list block %6lu Cannot write inode %6lu Invalid system size "%lu" Invalid starting block "%lu" Invalid number of inodes "%lu" @(#)makfs.c 1.5 (1/22/87)1Q68010 XPU 151 Makfs source 1.5 Copyr20NVxH0N&n E/ HyN \PO-@Jg ËҀË``H0;N$$$$$$$$$*6666**$$ ` + ሀ$pL N^NuNVH&nHnHxUNFPO.Jg `&pLN^NuH0/2/ AH@B@2/Ё/@L.Nu//lD//lDa:Jo lDJolD/_.Nu//lD//lDaJo lD/_.Nua.Nua /o.NuJof&/p0/?@0/?@H@?@ NuH)maklink.c 1.2 (1/22/87)a]1Q68010 XPU 151 Maklink source 1.2 Copyright (c) 1986 Cromemco, Inc.  f`DJ"0 /Hy0ZHxN / LN^NuNVH0&n E/ /./.N@gS@fFg&R-K , ` HH// NTPO&@Jf`8R` HH// N\3F\3N\3X\3^ DparityON LINEON LINEPAPER OUTPAusePSthimblePresentRAWREADYREADonlyRESumeRETENsionRETRYRIBBON OUTRPMRewindRewindingRunningSECSIZSECtorsSIGAllcharsSIGCharSIGHUPallSIGenableSIZESOFTerrSURfacesSecureStatusTABexpandTANdemTDelayUnloadVERIFYVERsionVOICEcoilWRAParoundWRITEprotectWidthWrt protectXMMTuart TerminalQuadart/Octart TerminalParallel PrinterQuadart/Octart Serial PrinterSystem TimerSystem deviceFloating Point ProcessorFully Formed PrinterH0&n E7N`RRg4 A\Dg Z_DJgHHм `HHHHgg . ` /Hy7N/.NJPO/NBPO .L N^NuNVN^NuNVH0$n &nBBBB  g  g  g  fR` +fR` -fp-@RB A\Dg Z_DJgHHм `HH.p0nr9m0`panrfm Wv``Hx /N П, Ї(RR`Jfp`P A\Dg Z_DJgHHм `HHrhf,R`Jgp` .g"D`"$ L N^NuNVH0&n$n JRgR` L N^NuNVH0$n G'n'n'n / Hx 'x'T ! !6!l!"" "D""h"z""#@#d###$*$$$%%J%&4&F&j&X&&&'x'T !l!" ""$*&'x'T !6!l!~!" ""$*%%J%&&'x'T! !6!l!~!" "z"#$*$%%J%&&'x'T! !6!l!~!" "z"#@#$*$%%J%&&&'x'T! !l!" "z""$*$&'x'T@@@   y0000000000 0 0 0 0 001}1 ~111 1&\12 <1: \1B D1J D1R  D1Z@\1` @1f @1l Dgument: "%s" Illegal argument "%s %s" Illegal argument "%s " Illegal argument "%s " Illegal baud rate "%s" Illegal argument "%s" %s %ld:%ld %lc%-15s%lc%-15s %-10s%-5ld %-10s^%-4lc %-10s%-5lc Baud A %-8s Baud A %-8ld Baud %-10s Baud %-10ld6666Not present %-15s %-8s%02ld.%02ld %-5s%7l,dK %-10s%-5ld %-8s%06lxh@(#)mode.c 1.42 (1/5/87)Hangup5075110134.5150200300600120018002400480096001920038400CtswaitNochgUninitAutoABortenableADDr\3h\3p \3t\3z\3<3@ D3 D3\3 D3<3\3\3  3  3\3 L 3\3\3 ,4  D4 4<4 $4&\40\48 \4@<4H\4P Tuart Serial PrinterNine Track Tape DriveMaximizerUart TerminalOctart TerminalParallel PrinterSerial PrinterOctart Serial PrinterCharacter DeviceSmall FloppyLarge FloppyFloppy TapeSTDC Hard DiskSMD Hard Disk fixed partSMD Hard Disk removable partUniform Style FloppySystem MemoryRAM DiskIMI Hard DiskBlock DeviceHalted (restart)Halted (resume)RunningStep modef1Q68010 XPU 151 Mode source 1.42 Copyright (c) 1986 CromemcNPO.Jg `$pL N^NuNV-nHnHx NPON^NuNVH0G$n'n'n / HxNPO.Jg `$ pL N^NuNVH0$nG'n'n 'n 'n/ HxNdPO.Jg `$ pL N^NuNVH0G$n'n'n 'J/ Hx N PO.Jg `P . SkF n>H0;N$$$$$$$$$*6666**$$ ` + ሀ$pL N^NuNVH0G$n'n'n 'J/ Hx!NPO.Jg `P . SkF n>H0;N$$$$$$$$$*6666**$$ ` + ሀ$pL N^NuH0/2/ AH@ !Z!l!" "$*#$$%%&%'x'T! !l!~!" "z""$*$&'x'T!#.&%8% !$!""V# ""#v##$<$$%\%%&' ' !H!!#R$`%n%%&&"&|&&''0'f!!#R$`%n%&&"&|&&''0'f!#R%%&&"&|&&''0'f!H!!!"2#R$`%n%%&&"&|&''0'B'f 1r\1z \1\1\1@\1\1@ D1  1\1 D1\1 D1L 1\2\2\2 \2\2 \2,\28L 2> \2H<2NL\2V D2\\2f D2lC ,2ressBINaryBLKSwrtBLKsizeBMarginBSTEPBaudBaudBlockCBreakCDOSCHECKCRDEViceCRIGNoreCROMIXCWidthCYLindersCorr errorCorrection (seconds/100 days) DDensityDELAYDELEChoDIScardDSideEChoEOFcloseESCreturnEVenparityEnd of tapeEraseFFexpandFMarkFNkeysFORMsFile markFileFreeGMToffset HANDshakeHARDerrHUPenableHard errorHigh speedIBsizeICacheIMmediateechoINLLCaseLHeightLKillLMarginLengthLoad pointMFreeMOUNTedMShaMSysMTotNLEChoOBsizeOD o, Inc. r/etc/passwd/dev/7t7x7|7sh-csh-cI$I$HBP* BP  BP(T  @PT* B!P* BP(  BPT*@P(T*@P*BP("@PT* B PT* @P(T UUUUUUUQUUUUUUUUEUUUUUUUTUUUUUUUUUUTUUUUEUUUUTUUUUUTUUUEUUUEUUUEEUUUUQUUUUUUTUUUUUUTUTUQUUUTQEQEQEQDQEQEQT((/0Hy2 /N ` Hy20/NPOL N^NuNV/9@ HnN $PO/Hn/.N N^NuNVH,.G$Hx /NPOJ@g"/9@HnN PO/Hn/N `& 9@S.` Hx /NPOSJnHx /NPOLN^NuNV/9@HnN PO/Hn/.N8 N^NuNV/9@HnN XPO/Hn/.N N^NuNVH0&n E..`/ // /.N  ËҀËJnL N^NuNVH0EG@DB@LB./ /.NPOJf. 0m( 9n"Rp o//N6HH0ҟ.`Jf~ A\Dg Z_DJgHHм `HHmgr]gh]gpBHx/9@NHnHxBHx/9@NzHnHx0HxHx/9@N\BJ@(f BNXO` @(lBBHn y@, /0NL.Jg"B y@, R/0/HxN! `R/.NlXO,/.NXO g Sg Sf0g(R`* 9@@ѓ @(m 9@(S&JlB`&@(`ZHnHx(/.Hx/9@NHnHx/.Hx/9@NbHnHx0/.Hx/9@NDpgHn/./N pgHn/.HxN pgHn/.HxN pgHn/.HxN /9@NXOp`Hy1XHxNPOHxNVXOL N^Nu JRHH.JgtpA_Dg rZ\DJg м ` .&n`Jf`J\HHfJg`6J+fp'@`Jg n R'pJf` `~`< `pL N^NuNVH0&n$n fHnHx BN EB*B-KBB/.N .S// /.N ,lp`Jf`plHx/ HkNr JgpmB o*B` 3:xfR`Rn/ Ї// N *` S 3:f`SJnJoS.` S 3:f`SJn rfHHxHy2HsxN Jg.EHx VHs/ N B*Їև`ֆ&n,B` rn 3:x `VJ@(g B@@~`N`>J@(g#@H@@~`N`"J@(g 9@HD#@@~`Np`~Jl/NXO/NXOJmz`B/ NXO L N^NuNVH0GE/ Hx/9@N~ / Hx/.Nl gp`2/ Hx/9@NN / Hx/.N< gp`pL N^NuNVH&nB`, y@ // NPOJg/9@/9@ NJPO``R m LN^NuNVHy2 y@ /NPO/9@/9@ N PON^NuNVH0&n$S . S/Hk/ N . S'L N^NuNVH0$n|0* Hgp`&n 9@A*opSJm R` R KR` R KR` Єm`" SJg Rr`B2x ```pL N^NuNVH0$n A-H&nBBBB JRgF %f4 JR H@mg0[@g@f g@9gW@gY@gS@g @fg .X @"*0Jox`Bo .ڀJgR +f JRHHڀ|. .f KR`pB`/Hx N  x/Hx N*Rpnpl$"SJ6f dg"HH0lS` SJg KR6xHHм0``, JRHH-@ JRHH-A`x` v` KR` KR`B L N^NuNVH0$n GB/ ././bin/more.bin 7442 77777 77777 24605 4007606004 7002 0UgxSgVfxg@Xg,Wg(gg fRg `Pp&#@H`Dp&#@H`8p&`2p&`,p &`&p&` p&`p&#@H`p&#@H`BJ@Lgp &L N^NuNVp#@LHnA//N> N^NuNVHx/9@NPON^NuNVN^NuHop0//NP6N@FNuNVH&nJk gP/ NXO.0+ HgHx/+N8POBBk pH'@2+H/NXOJgp` `pLN^NuNVB/. HnHxNN^NuNVH0&n$n Hx/ N PO rfp7@ ` wfp7@ ``"Hn/.NLPOJg`7nB `Bk pL N^NuNVH0NVH0G@P,<HxN"XO$@JgbBBHnHy1N*JgBHy1/HxNf`"Hx/ B/.N.*JgHy1HxNPO`Hy1/ N(PO#@Hy1/ NPO#@// Hy1/ N.Jm#@ RËҀË R// Hy1/ NT.Jm#@ RËҀË R// Hy1/ N$.Jm#@ RËҀË R// Hy1/ N.Jm#@ RËҀË R/.NXO/ NXO`BBz/HxN$ L N^NuNVH0E@ 9@XT//NNvXO&@Jg:#@ ËҀËB` y@ !"9@TЁf V 3@f X*`j rn^ 3:XfVHx RHs RHsND Jg6 R(` 3:Hf`Rn  /HsHHsXNf `RnY / XHsHsxNB RnDB3hpL N^NuNVH0&n$n / NXO&@Jg8Hx/ / N Jg" +#fHnHkNPOJg .```pL N^NuNVH0$n &nBBBB  g  g  g  fR` +fR` -fp-@RB A\Dg Z_DJgHHм `HH.p0nr9m0`panrfm Wv``Hx /N  П, Ї(RR`Jfp`P A\Dg Z_DJg R @p`/ NXO.Jl`JR@4 KRJ0g,  WDf  WDf  WDf  WDJfB  f`` fp`6J0 gp fR@8J0gJg J@PO`/9@H/ NPO,JfB` //NPO`J@(g" y@, 9@$/0Hy1/N /9@8Hy1/N `x/NzXO`nHy0"Hy2/NHHм `HHrhf,R`Jgp` .g"D`"$ L N^NuNVH0&n$nB/ N`XO&@JgHx/. / N Jg +=fVB 0m 9n KRHH0( :gvlnJfp` ^f.RJg :fp`| R KRHH¼`, \fRH@m^@mgY@gQ@gXY@gdU@fgx@mfg@k @ nH0;N|||||||| @0fp` Rr R` Rr R`~ RrR`p Rr R`b Rr R`T RrR`FzB`  KRHH0,SJg 0m 7o  Jgp` .N^NuNVH0$nYJ2g y2&h 2o#2` 2l o #2&k` y2!J%K&y2 Гf k ѓ k'h`&k Гf k ѓ k'h`#2` #2%JL N^NuNVN^Nu"/g@ o/4|gSH4H@04<A` Qd`QNu$/ gL o"o02 |f|g `&|g SrB`"Qd$`QdNu$/ g o"o`QNu"/g8 o4|gS4<A` Qd`QNuNVH0$n G'n'n'n / Hx Nf20 dNVHN t*.&n / Hy NPO,Jg ËҀË``(JfN>.`pf/+/NPO.`` `Hy >HxNHPOpLN^NuNVtH0EGtBB/ Hy Nr.JgBHy /HxN`\HnHx/ /N .JfgHk / Hy fHxN`pfB`BB/HxN/N>XO L N^NuNVdH0E&n |`HnhHx/N RpnHntBNPOHnpBNBPOBHxBN HndHxBHxBN/.HnNPOHn/ N POHn|HnN^PO.JgB/ /HxNЁ/@L.Nu//lD//lDa:Jo lDJolD/_.Nu//lD//lDaJo lD/_.Nua.Nua /o.NuJof&/p0/?@0/?@H@?@ NuH$/r2/0/R@eL?A2/?A"/ /2/2/HABAdS@ԯ/@/BLNu/A2/`NVN^NuBH />A/NpXLDXNuaaaaaaaaNV-nHnHxFNPON^NuH $oL /N@QHUHHLNu /"/N@UHHNu"_" _N@UHH//N"/ / o "oN@UHHNuDIBHH@  @@Hy |HxNPOHx/ BN .HnHxHxHxBNHy HxNPOJgBB/HxNp`,Jfp`$/ / N6POJgp`Hy HxNRPOpL N^NuNVH0EGpHx`Hn/. N .Jg `BHx/ Hy N\.JgBHy /HxN`B` Jf`./B/N HnHx/ /N.JgpfBJgBB/HxN``Hx/ N PO/./ N ^POHnHk N PPO/B/N HnHx/ /N.JgBB/HxND/N XO L N^NuNVH0$n &n` Jfp`jRR A\Dg Z_D standard input r File %s Line %l,d %s --More--(%ld%%) Next file: %s End-of-file@(#)more.c 1.5 (10/8/86)H(1Q68010 XPU 151 More source 1.5 Copyright (c) 1986 Cromemco, Inc. tc=### # ####Unexpected signal number %ld I@P%BBBHn/.N ,JfHxHnl/.N JfHxHnlHnlN rnhHn/.tNNPOJgVHx/.lNPO,/NXO$@Jg8Hx NrXO&@Jg //.l/ NF 7n'J&. `/ NXO`b/.NXO/NvXOL N^NuNVH0G$n / S// /.N ,Jg `LJg@ S2HH.p WDf r WDfp WDfp WDJf`S` B2pL N^NuNVH0*. &nJg *g ;fp`B Ю,g  g  g  g  fR`$Kg :gR` l$ + g + g + g + fS`S FB E R" ! PO.Jg `$pL N^NuNVH0&n E%n/ Hx N*PO.Jg `&pL N^NuNV-nHnHx NPON^NuNV/ G'n'n 'n / HxNPO&_N^NuNVH0$nG'n'n 'n 'n/ HxNPO.Jg `$ pL N^NuNVH0$n G'n'J'n / HxNLPO. n L N^NuNVH0$n G'n'J'n / HxN PO. n L N^NuNVH0&n E%n/ HxNPO.Jg `pL N^NuNVH0$n G'n'J'n / HxNPO. n L N^NuNVH0$n G'n`/.p/.t/.|N .JgBHy /HxN``HxrHy N PO// / N .Jg/ / /HxN`(/ NXO.Jg B/ NPO`/ HnNPO.HndHx/.dHxBN$BHxBN L N^NuNVH0$n &J` /g ^f R&@Rf .R @-H A\Dg Z_DJgHHм `HH nJgR`L N^NuNVxH0&n$n / HnN POHnxHxHnNn .Jf pxg~`/ HxHnNJ . L N^NuNVdH0Gd|J gHy &N6XO*Hy 2N(XO$@BBHnHy NVJfHxHnd/.N@  @  H D@ D    H A@ D"$@"@HB@!B @JgHHм `HHHHg A\Dg Z_DJgHHм `HHHHL N^NuNVH0&n /f8Hx/ NPOoHy HxNXPOp`/ /. N 2PO`ޕ. ` G /f$GR Gf gPBHnxN .N XO,JgB/ /HxN `HnN XOHnxN XOp/" R&A` HnN xXOHxHnNNPO-@Hx/ N>PO".ҀToHy HxNPOp`(/ Hy Hn/. NbPO/NZPO/NRPOpL N^NuNVN^NuHop0//NP6N@FNuNVH0G$n B` n 0 xo nxx``Rp n R R B3xHn./bin/mount.bin 7442 0 0 17567 4007606027 6712 0// /N g :gR`gR```b E B L N^NuNVH0&n g .&$K&G` L N^NuNVH0&n E!`RRg4 A\Dg Z_DJgHHм `HHHHgg . ` /Hy!/.NPO/NPO .L N^NuNVN^NuNVH0| n $p" g JR -fgR -f`J*WDHH* JRHH.JgtpA_Dg rZ\DJg м ` .&n`Jf`J\HHfJg`6J+fp'@`Jg n R'pJf` `~`< `pL N^NuNV/ &nHH g\` +&_N^NuNVH0'J/ HxNVPO. n L N^NuNVH0G$n'n'n 'J/ Hx!NPO.Jg `P . SkF n>H0;N$$$$$$$$$*6666**$$ ` + ሀ$pL N^NuNVH0G$n'n'n / Hx(NPO.Jg `$ pL N^NuNVH0G..$n Joplp"`p'GA f SA2"0` "'A/ Hx@NPO,Jg `2 n-H SA2"+fC ` + n pL N^NuNVH0$n G'n'R'n 'n/ HxPNPO.Jg `$pL N^NuH0/2/ AH@B@2/ JfHx/ HndN D .rlHn/N xPOJgtJgnpl kg//+NtPO g`pl k g/ /+ NRPOg`pHn/+NPOJg`Z .찮g`LB``D/.NXO`B L N^NuNVH0&n $n`/ /+N VPOJfp0+`&S fpL N^NuNVH0GEHy &/.HnN PO/N POBB/ HnNJgp`HxHn/N .Jf0Hx/ HnN ro`Hy v/NHPOJf``/NXOpfr `$JgBB/HxNDp` /+N XOL N^NuNVxH0Ex&nJfp`HnHxBHxBN 0 22>cfsn [n]SPACE Forward n screenfuls [n]RETURN Forward n lines = Print current position DELETE Display --More-- h Print this text b Begin of file [n]n n-th next file [n]p n-th previous file q Quit /dev/ttyUsage: More [-cs] [-n lines] [file file ...] /etc/termcapsCannot read terminal capabilities licocehososeCannot "More"/ N*POHx/ HnN Jfp`pL N^NuNVH0&n $n/ N(XO.Hn/NPO/ HnNPOL N^NuNVH0$n&JzBx `` KRHH.pA_Dg rZ\DJg м ` . , VDHH  n&J *gzSJf L N^NuNVH&n BBB`,Jl, A!l"0ӓcRA  Rp nLN^NuNVH0&n$n (p*B` *pA  Rpn~`( ,pora`p" Ёx (SJl~`( ,pora`p" Ёx *SpoB*L N^NuNVN^NuNVhH0 &n $n .SJggrt `RR`pL N^NuNVH0$n &n` Jfp`RRgHHHHL N^NuNVH&n~` KRpf ` R o . LN^NuNVH0$n &nBBBB  g  g  g  fR` +fR` -fp-@RB A\Dg Z_DJgHHм `HH.p0nr9m0`panrfm Wv``Hx /N П, Ї(RR`Jfp`P A\Dg Z_DJgHHм `HHrhf,R`Jgp` .g"D`"$ L N^NuNVH0&n$n JRgR` L N^NuNVH0./bin/move.bin 7442 0 0 10657 4007606052 6505 0PO.Jg `$ pL N^NuNVH0$n G'n'J'n / HxNdPO. n L N^NuNVH0$n G'n'J'n / HxN$PO. n L N^NuNVH0$n G'n'J'n / HxNPO. n L N^NuNVH0G$n'n'n 'J/ Hx NPO.Jg `P . SkF n>H0;N$$$$$$$$$*6666**$$ ` + ሀ$pL N^NuNVH0G$n 'n/ Hx4NPO.Jg `$ pL N^NuNV/ G'n'n 'n / Hx5NPO&_N^NuNVH0G$n 'n/ Hx6NPO.Jg/.NPXO/.NFXOJf/ NXO L N^NuNVH0GE/ Hx /.N / Hx /. Nv gp`0/ Hx /.NZ / Hx /. NH gp`pL N^NuNVH0&. B/NXOHnHx/./.N*Jf .Ю-@&n$K`~ мl м` .,( ` Dg`Rnf0Jf$ oHn // /N*Jg`| ހ`Jg/Hx/N0 $KB&F mzJf"oHn // /Nr*Jg`*`pf Jg/Hx/N /NXOp`$BB/HxN fp f HxNXOpL N^NuNVH0E@ @ t( r/etc/mtab/etc/mutab/etc/passwd/etc/groupUsage: mount [-r] [devname dummyname] /dev/%-10s %s mountPassword: Invalid password Dummy pathname too long Dummy pathname too long /@(#)mount.c 1.7 (1/22/87)1Q68010 XPU 151 Mount source 1.7 02 |f|g `&|g SrB`"Qd$`QdNu$/ g o"o`QNu"/g8 o4|gS4<A` Qd`QNuNV/ &n-KHnHxN(PO&_N^NuNVH0$n G'n'n'n / HxNPO.Jg `$pL N^NuNVH0$n G'n'n'n / Hx NPO.Jg `$pL N^NuNV-nHnHx NxPON^NuNV-nHnHx N\PON^NuNV/ G'n'n 'n / HxN0PO&_N^NuNVH0$n G'n'J'n / HxNPO. n L N^Nu..E"0por` X"¼Ё".JgD&R&k* n. Pn Г&@&` R!k fBA `<$&kf м,/N&XO&@Jfp`& X/N6XO`L N^NuNVB/.HnBNJgp` .N^NuNVH0$nYJ"0g y"0&h "0o#"0` "0l o #"0&k` y"0!J%K&y"0 Гf k ѓ k'h`&k Гf k ѓ k'h`#"0` #"0%JL N^NuNVN^Nu"/g@ o/4|gSH4H@04<A` Qd`QNu$/ gL o"o02 |f|g `&2 (NVpH0N,.&n B/ HyNPO.Jg ËҀË``po`HnHx S/3N JftpflS"/3HntNPO$@ */g *^gHy/ NPO$@B`, /3Np./ NPOHnt /3NPORn`pf/+/NjPO*`` `"HyHxN POHyPHxN POpL N^NuNVH0&n$K KRg /g ^f$K` L N^NuNVH0$n &n/ / N JPOJfNHxvHyNvPOJg/ HyHxN ` / NXO.JgB/ /HxN X~`,BBHn/ N . `$ pL N^NuNVH0G..$n Joplp"`p'GA f SA"4"0` "'A/ Hx@NBPO,Jg `2 n-H SA"4"+fC ` + n pL N^NuNVH0$n G'n'R'n 'n/ HxPNPO.Jg `$pL N^NuH0/2/ AH@B@2/Ё/@L.Nu//lD//lDa:Jo lDJolD/_.Nu//lD//lDaJo lD/_.Nua.Nua /o.NuJof&/p0/?@0/?@H@?@ NuH$/r2/0/R@eL?A2/?A"/ /2/2/HABAdS@.. ,.GHnHxNPOJgBBHxHxN p`rHnBNPOBHxBN / Hx/Np BB/Hx/N/ Hx/NN BB/Hx/N/ Hx/N, BHx/Hx/N/ Hx/N BHx/Hx/N/ Hx/N BHx/Hx/NHnHx /N HnBBHx /NHnHx /N HnBBHx /NHnHx /Nr HnBBHx /N/ Hx/NN /Hx/N /.HxBN pL N^NuNVH0&nEHnBNDPOBHxBNr Hx/ NzPO/ BBHx/ NfCopyright (c) 1986 Cromemco, Inc. 2ZcYyk(d)Pv,||*B EF~NRq0bB$LgLz]j{FbIʌkpEsSh<:r}Wځ?}Ǝgǔ2ylaLr/etc/passwd/dev/" "$"(",sh-csh-c"$&(*,.0Unexpected signal number %ld *NVH0$n G'n'J'n / HxNPO. n L N^NuNVH0G$n'n'n 'J/ Hx N|PO.Jg `P . SkF n>H0;N$$$$$$$$$*6666**$$ ` + ሀ$pL N^NuNVH0G$n'n'n 'J/ Hx!NPO.Jg `P . SkF n>H0;N$$$$$$$$$*6666**$$ ` + ሀ$pL N^NuNVH0$nG'n'J'n 'n 'n/ Hx"NPPOL N^NuNVH0$nG'n'J'n 'n 'n/ Hx#NPOL N^NuNVH0&n $n-J-KHnHx$|g SrB`"Qd$`QdNu$/ g o"o`QNu"/g8 o4|gS4<A` Qd`QNuNV/ &n-KHnHxNPO&_N^NuNV/ &n-KHnHxNPO&_N^NuNVH0$n G'n'J'n/ HxNPOL N^NuNVH0&nE%K%n / HxNzPOL N^NuNVH0$n G'n'n'n / Hx NBPO.Jg `$pL N^NuNV-nHnHx NPON^NuNV/ G'n'n 'n / HxNPO&_N^NuNVH0$nG'n'n 'n 'n/ HxNJgB/ /HxN (~`HnHx/.N JgB/ HxHxN ~`HxtHyNPOJgFHnHx /.N ^ HnHx / N JfHxHnHnN Jn`dBHxtHyNhPOJVDfHxfHyNPPOJVDJgp`pA/Hn/ N.JgB/ /HxN 2~`/./.NPOJg/ HyHxN ~`BHxHnBN 0.JgBB/HxN ~`/././.N& .Jg``/./.N^PO.Jg`JHxvHyNrPOJg/ HyHxN \ / NXO.JgB/ /HxN T~BHxHnHxN ԯ/@/BLNu/A2/`NVN^NuBH />A/N4XLDXNuaaaaaaaaNV/.Hy"THxNl HxNXON^NuNV-nHnHxFNPON^NuH $oL /N@QHUHHLNu /"/N@UHHNu"_" _N@UHH//N"/ / o "oN@UHHNu@   @@ /.HxBN@ L N^NuNVN^NuHop0//NP6N@FNuNVH0| n $p" g JR -fgR -f`J*WDHH* JRHH.JgtpA_Dg rZ\DJg м ` .&n`Jf`J\HHfJg`6J+fp'@`Jg n R'pJf` `~`< `pL N^NuNV/ &nHH g\` +&_N^NuNVH0&n $n .SJggrt `RR`pL N^NuNVH0&n$n JRgR` L N^Nu"/g@ o/4|gSH4H@04<A` Qd`QNu$/ gL o"o NPOL N^NuNVH0G$n 'n/ Hx4NPO.Jg `$ pL N^NuNV/ G'n'n 'n / Hx5NtPO&_N^NuNVH0$n G'n'R'n 'n/ HxPN:PO.Jg `$pL N^NuNV-nHnHxFNPON^NuH $oL /N@QHUHHLNu /"/N@UHHNu"_" _N@UHH//N"/ / o "oN@UHHNu  @@g Z_DJgHHм `HH".gHHHHL N^NuNVN^NuHop0//NP6N@FNuNVH0| n $p" g JR -fgR -f`J*WDHH* JRHH.JgtpA_Dg rZ\DJg м ` .&n`Jf`J\HHfJg`6J+fp'@`Jg n R'pJf` `~`< `pL N^NuNVH&n~` KRpf ` R o . LN^NuNVH0&n$n JRgR` L N^Nu"/g@ o/4|gSH4H@04<A` Qd`QNu$/ gL o"o02 |f2@ 0NVH0N (,. G E0// N PO-@Jg܀``HnHxHy `N BB/ Hy 8N x.JgBHy 8/HxN `lHnHx0Hy0/N .JgHy jHxNJPO/N fXO `0p090fHxHy0HnN B. FJfJg`Jg*Jf JfJg`N(./N XO `/N XOJg$BHx Hx HxHxN Np`Jg BHx BHxHxN N|p`lNtp`dJf JfJg`6Hn/NPO./N lXO `6/N `XOHy HxN,PO..$n Joplp"`p'GA f SA"T"0` "'A/ Hx@NPO,Jg `2 n-H SA"T"+fCf ` + n pL N^NuNV-nHnHxCNHPON^NuNVN^NuBH />A/N tXLDXNuaaaaaaaaH $oL /N@QHUHHLNu /"/N@UHHNu"_" _N@UHH//N"/ / o "oN@UHHNuH@ @ @$@  @    @@ /90N` HnHx0Hy0/90Nt.Jg E/Hy!lHxN `~Hy0 E/NTPOJfHxHy0A " Z/Np B9 7BHx/ Hy "Np.JgBHy "/HxN  `HnHx/N Jf`/NHXOJg`Hx/NPO/. Hy!/N & B/NPO/ HxHy0BN.JfHnHx/N Jf`\Jg SA0 0 fS`Jg SA0 0 fS`B`>A0 0 hl.J f 0 hWDf 0hWDJf A0p?hRmHx/NPOHxNxXOHy0/Hy0/N.BNVXOJ./bin/ncheck.bin 7442 77777 77777 5365 4007606103 7255 0 @ftv/Usage: Move [-ftv] source-file destination-file Move [-ftv] file-list destination directory %s Can't move %s to itself %s @(#)move.c 1.6 (1/22/87)+1Q68010 XPU 151 Move source 1.6 Copyright (c) 1986 Cromemco, Inc. |g `&|g SrB`"Qd$`QdNu$/ g o"o`QNu"/g8 o4|gS4<A` Qd`QNuNV/ &n-KHnHxNHxHy0A " Z/N B 7J90gBHx  *!yn2a/dev//etc/whoCan not send messages to %s /dev/ttyUnable to determine who I am Usage: msg [-yna2] [user-name or devname] Options -y -n -a are only legal individually with no other argument Messages enabled Messages disabled msg.tmpSTDINMust be privileged user %s Broadcast message .... User name "%s" nog"/NFBHy "/HxN ( `B/NPO`Jg"pg/N BB/HxN `p/NXOJg`@Hx/NbPOHy!/NPOB/NJPO/NXOHy!HxNPOp`"Hy "Hy BHxNp /NXO L N^NuNVH..GJJ g"J gHy!/NPO` Hy!/NPO`J f Hy!/NPOLN^NuNV/HxN B/.NPO.BN XO .N^NuNVJg$Hy0Ax/HxN /.NXO` BNXOHy0/90HxN\ N^NuNVN^NuNVH0&n$n ` Jfp`rRR A\Dg Z_DJgHHм `HH-@ A\D20` NVH0Np&n / HyNPO.Jg ËҀË``dHxiHyNPO$@Jg Hx(Hy / N" # Jf`. .gSfgHyN4XO` /N*XO`` 9 `HyHxN2POpL N^NuNV/ &nA // N POJgp# &_N^NuNVH0&n,. $nJ g$B` A f`R mp`./ p+//HyBHxNp0+VDHHL N^NuNVN^NuHop0//NP6N@FNuNVH0$n &nBlF RHr/ NNPO&@Jg. ,fR  g  g  g  fR`./bin/msg.bin 7442 77777 77777 12521 4007606072 6625 0PO. n L N^NuNVH0$n G'n'J'n / HxNPO. n L N^NuNVH0G$n'n'n 'J/ Hx NlPO.Jg `P . SkF n>H0;N$$$$$$$$$*6666**$$ ` + ሀ$pL N^NuNVH0G$n'n'n 'J/ Hx!NPO.Jg `P . SkF n>H0;N$$$$$$$$$*6666**$$ ` + ሀ$pL N^NuNVH0$nG'n'J'n 'n 'n/ Hx#N@POL N^NuNVH0G$n 'n/ Hx4NPO.Jg `$ pL N^NuNVH0GHnHy "N.JgJgBHy "/HxN `/.NXOJgHy "Hy BHxN `BB/.N Hy!R/.N PO/ Hx/ /.N .Jgpg A!",`xHxNXOpg4Hy0// /.N .JgHy "Hy BHxN > BN\XOJg/.NJXO`/.NPOB` A0-p".t¼-A .lD//lDaJo lD/_.Nua.Nua /o.NuJof&/p0/?@0/?@H@?@ NuH$/r2/0/R@eL?A2/?A"/ /2/2/HABAdS@ԯ/@/BLNu/A2/`H $oL /N@QHUHHLNu /"/N@UHHNu"_" _N@UHH//N"/ / o "oN@UHHNu @@" H@ Ti/Usage: NcheckR mZRpnJL N^NuNVH0GE0Hy$,HxNjPOHxP/ BN 4 Jg ng Nfp0^DHH ` yWDf YWDJf`pgHy$X/NPOHxP/ BN A\Dg Z_DJgHHм `HHg8 raWDf tdWDf reWDJf`t ref`VBpgTHy$vHxNdPOHxP/ BN. Hx/ / N *po lrmJfB`SJlBv`&(JlB-|` -k-kJl Bp-@` -k-k&`'n`'n`jA4Hx/2NVH0NG0E4BA ,pf # `*/. Hy NPO-@Jg Ѯ ``|pg`pp-@Hxv/NHy HxN Hy HxNPOHy HxNPOHy HxNPOHy! HxNPOHxP/ BN J4 KR4 KR"R KRr/ Hy dNPO&@B` KRplR m/ Hy pNPO&@Rpn|A4 м]o "KRpN`pL N^NuNVH0E..G0"J fD/Hy%hHxN HxP/ BN JfB`/ / N6POJf`l``J g/Hy%HxN J fT//Hy%HxN HxP/ BNZ Jf'G`Hk/ NPOJf`m +l``J g/+Hy%HxN 6 L N^NuNVH0&nEHy%/ NPOB`D 3Ax\Dg 3Zx_DJg3xHHм `3xHH2xHHg[`Rpn Z/ Z/N6POHx/ /.N.Jfp !f2*H¼gB*/ +/WDf +^WDJg `Hy/ NPO/NPOHy!(BHy N .Jg`L/9!p0*/Hy y!N Jf$ y!p(rf a.Jg``"pfB/.NXOBJgpgBHy /HxN~ L N^NuNVN^NuNVH0$n &nBBBB  g  g  g  fR` +fR` -fp-@RB A\Dg Z_DJgHHм `HH.p0nr9m0`panrfm Wv``Hx /N П, Ї(RR`Jfp`P A\Dg Z_D-@"<®-Ato@ l6po.Hx/.N".ҟ//N".ҟC$9 R0mnNHxN(XO`bN .A0-HC-Ip=@J gJfHy#"HxNPO/.HxN PO 90"`p=@BnB`6 A0r20CB1 r20RR rbJ g&p/Hy#0HxNf HnHxNPOHnBHnHx/90*N.JgBHy02/HxN8Rp0&c8J f`8HxdhHy4NXPOB`B`A4pHx/NlHxNd П-@r=At=Br=AJ [-i inode-list] [directory-name] %6ld %3ld %s @(#)ncheck.c 1.3 (1/22/87)61Q68010 XPU 151 Ncheck source 1.3 Copyright (c) 1986 Cromemco, Inc. /I N BHxN : ПHx/+N *ПЫ, raf"FJfR0 F 9 ` FgS0 FBR +oR +ovRld`p0^DHH L N^NuNVH0GE0Jg6pVrTAtOBpC@B`plxhR mA4-HB0B`ZB`LB`@ .R @g0"90$p ԀԄ%R0p0lS0RpnR mRpn.90` r%RpnB+p7@Bk Bk Bk'JHnB/ Hx/90*N T&JgBHy02/HxN g(p+/p+/p/Hy$HxN p@7@Bk Bk g ng Nf`. yg Yf Hy!XHxNPOHnHxNPO``Hy!HxN^POHxP/ BN( Hx Hn/ N #0*rf` <gHy!HxN PO`Hy!HxNPOHxP/ BN Jg ng Nf` yg Yf p# ``J0.gHy!HxNPOp`Hy"HxNPOHxP/ BNZ Jg ng Nf` yg Yf p# `6`Hy"@HxNDPOHxP/ BN Jg ng Nf` yg Yf p# `` 9 gr`p"/Hy"nHxN HxP/ BN Jf p# `6Hy / NPOJg"p m ./Hn/ N:,Jg` gHy%HxNlPOp`Hy0.Hx/.N^ ,Jg`t0.HnHx /.N8 ,Jg`N ^lHy%HxNPOp`D/. Hx/.N ,Jg`/ Hy02NbPO .`B/ /HxNpL N^NuNVN^NuHop0//NP6N@FNuNVH0$n &nBlF RHr/ NPO&@Jg. ,fR  g  g  g  fR`Jf ``pL N^NuNVH0G$n / S// /.N,Jg `LJg@ S2HH.p WDf r WDfp WDfp WDJf`S` B2pL JgHHм `HHrhf,R`Jgp` .g"D`"$ L N^NuNVH0&n$n JRgR` L N^NuNVH0$n G'n'n'n / Hx N2PO.Jg `$pL N^NuNV-nHnHx NPON^NuNVH0$n G'n'J'n / HxNPO. n L N^NuNVH0G$n'n'n 'J/ Hx NPO.Jg `P . SkF n>H0;N$$$$$$$$$*6666**$$ ` + ሀ$pL N^NuH0/2/ AH@B@2/Ё/@L.Nu//lD//lDa:Jo lDJolD/_.Nu// g*p/ R/Hy#L/NHnHxNPOHnBHnHx/90*N.JgBHy02/HxN^RprbRR m@pgPNp0lHy#nHxNPOJ gp0o"90`p"#0` NTJg``HxNXO/90*NXOJ gHy#HxNPOp`Hy#HxNPOpL N^NuNVH0GzE4B0Hy#HxNPOHy#HxNPOB`B`BB`| JRgrJf//Hy$HxN~R0 R/Hy$HxN HH fHy$$HxNPO` op*`p /Hy$&HxN Rpn~JgHy$*HxNPO./bin/oldtape.bin 7400 77777 77777 21713 4007606135 7464 0Bk'JHnB/ Hx/90*N &JgBHy02/HxN g(p+/p+/p/Hy$HxN DJfg B0B` r%Rpn`Hy%HxN POHy%6HxN POp-@-@B0` 90-rrf`~ .r* ., <(fg//Hy%RHxN -E-F R/Hy%`HxN d R0p0nlHy%fHxN @POL N^NuNVH0$n &n KRp,JgB` JRRnR` L N^NuNVH0EBG4/ Hy PNPO&@B`~/ Hy \NPO&@ A0C" 1 KR N^NuNVH0| n $p" g JR -fgR -f`J*WDHH* JRHH.JgtpA_Dg rZ\DJg м ` .&n`Jf`J\HHfJg`6J+fp'@`Jg n R'pJf` `~`< `pL N^NuNV/ &nHH g\` +&_N^NuNVH0$n &nBBBB  g  g  g  fR` +fR` -fp-@RB A\Dg Z_DJgHHм `HH.p0nr9m0`panrfm Wv``Hx /N П, Ї(RR`Jfp`P A\Dg Z_DJgHHм `HH./bin/passwd.bin 7442 0 0 16301 4007606211 7025 0$/r2/0/R@eL?A2/?A"/ /2/2/HABAdS@ԯ/@/BLNu/A2/`H $oL /N@QHUHHLNu /"/N@UHHNu"_" _N@UHH//N"/ / o "oN@UHHNu!   DDDDD @@  @@ D@  AI  @@D !DB @lN ,fHnl/NPO`Jfpn/. /N POJfz/+N XOJghAh'H/NXOpo"RA '` BHy HxNPOHxHnPNPOJg AP'H` A 'H`Hy HxNbPOHxHn/ /NHn/NPO`Jf/. Hy HxN& ~`$//.N@PO.JgBB/HxN/NXO/.NXO L N^NuNVH0GEB R'  RA'/NXOHy HxNPOHx/ NPOJgHn/ NlPOJf R'Hy HxNbPOHxHn`NPOJg RA`'HxHn/ /NBHx %01ld Too many bad sectors Usage: Oldtape [[-cdefvx] [-p #] [-s #[,#]] devname] ******************** ERROR MAP ******************** Stream Segment Sectors %6ld %8ld %3ld#%lc Do you wish to edit error map (Y/N) ? Command (Add, Delete, End) ? Enter side,segment,sector ? Error in writing VTOC status=%02lx error=%02lx %02lx Error in reading VTOC status=%02lx error=%02lx %02lx ******************** VTOC ******************** Stream Segment Sectors %6ld %8ld %3ldH&n Hn/ /.N , .JgBB/HxNHxN XOLN^NuNVH0E&nHnHxBHxBN Hy!HHxN POHx/ NPOJgLHn/ NPOHn/ HnNPO/NPOHnHnNPOHnHn/ NjPO/NbPO`BHnHx/.HxBN / Hy!THxN " HHL N^NuNVH0E&n Ю S./ BN POJf  f`  o o KR`B nHHL N^NuNVH0$nHn . S// BN r.JgB .B2  g  g  g  f&J`R+f`&J`RfS n  g  g  g  f KSBrhf,R`Jgp` .g"D`"$ L N^NuNVH0&n$n JRgR` L N^Nu"/g@ o/4|gSH4H@04<A` Qd`QNu$/ gL o"o02 |f|g `&|g SrB`"Qd$`QdNu$/ g o"o`QNu"/g8 o4|gS4<A` Qd`QNuNVH0$n G'n'n'n / Hx NPO.Jg `$pL N^NuNV-nHnHx NPON^NuNVH0G$n'n'n / HxNPO.Jg `$ pL N^NuNVH0$n2@,NVH0N&n E B/ / NPO-@Jg ËҀË``Hxd/ NxPOJfHxn/ NhPOJgN `.Hxg/ NRPOJgHy0BNPO`Hy0BNDPOBHxBNr Jg,`$/Hy >HxND /NfXOJg~XJf`4Hy HHxNPOHx HnN POJgHnN,XOJg~` `Hy PHxNPOpL N^NuNVH0$nHxgHy NPOJg A ( `A  &@HxdHy NXPOJg/ / NbPO.`PHxnHy N6POJf/ / NPO.`.HxgHy NPOJg/ / NfPO.` / / N`PO. L N^Nu@ l&pecsfdvxPN 2N N TNOnly one of C, E, or X options may be specified. %s Press: RETURN to supply default answers CTRL-C to abort program Warning: OLDTAPE will destroy all tape data Do you wish retension delay of 180 seconds (Y/N) ? Please wait fHn/.N ,JgB/./HxN`Hn/.NPO/.N XO L N^NuNV|H0GEB R'  RA'/NXOHy HxNPOHxHnN|POJgHnHnNbPOJf RA'Hy HxNPOHxHnN First stream: %ld. Last stream (0-%ld.)? <%ld.> Last stream: %ld. /dev/Cannot initialize mounted device Wrong version of tape drivers @(#)oldtape.c 1.15 (12/16/86)RB1Q68010 XPU 151 Oldtape source 1.15 Copyright (c) 1986 Cromemco, Inc. I0i@`HHL N^NuNVH0$n&n / / NPOJWDf RDHH.JgHy!XHxN PO L N^NuNVH0&nE / NXO.JgB/ /HxNp fB`R/. Hx/ N .JgB/ /HxN`(/.Hx/ N .JgB/ /HxN L N^NuNVH0$n&J` n g . R @`` R m L N^NuNVH0$n &n`Jfp`RR A\Dg Z_DJgHHм `HH-@ A\Dg Z_DJgHHм `HH".g A\Dg Z_DJgHHм `HH-@ A\Dg Z_DJgHHмG'n'n 'n 'n/ HxNHPO.Jg `$ pL N^NuNVH0$n G'n'J'n / HxNPO. n L N^NuNVH0G$n'n'n 'J/ Hx!NPO.Jg `P . SkF n>H0;N$$$$$$$$$*6666**$$ ` + ሀ$pL N^NuNVH0G$n 'n / HxBN>PO.$ L N^NuH0/2/ AH@B@2/Ё/@L.Nu//lD//lDa:Jo lDJolD/_.Nu//lD//lDaJo lD/_.Nua.Nua /o.NuJof&/p0/?@0/?@H@?@ NuHNVtH0EtGBBBHn/.N.JgB/./HxN` BHx/ Hy 4NP.JgBHy 4/HxN`Hy 4NXOHxHnl/.N JgZ/ HxHnlNv ,fHnl/N@PO`4/. /N jPOJfz` HxHn/ /NHn/N PO`Jf/. Hy vHxN ~`$//.N2PO.JgBB/HxN/NXO/.NXO L N^NuNVPH0GtEBBBHn/.Nt.JgB/./HxN`BHx/ Hy 4N.JgBHy 4/HxNt`dHy 4NXOHxHnl/.N Jg/ HxHnor tape retension time (180 seconds) Device name? Cannot initialize subsections Do you wish to examine VTOC only (Y/N) ? Cannot inititialize write-protected device Do you wish to edit VTOC only (Y/N) ? Do you wish to VERIFY tape only (Y/N) ? Number of VERIFY passes ? (%ld-10) <3> Please wait for tape retension time (180 seconds) Device name: %s Cannot initialize subsections Bad stream numbers Bad pass number Formatting Initializing stream %01ld Verify pass %ld on stream/.NPO/.N "XO L N^NuNVH0&nJg *g ;fp`B`z  g  g  g  fR`Jf`^ n !Jf` KR :f S$@`BS n " m  g  g  g  g :gR m L N^NuNVH0&n ЮU$@BB`/ n /0/ N *܅Ѕ .SoXpo8A!<0xHHo&/ Hy!D/ N ËҀË P,`/ Hy!F/ N ËҀËRRmt KRp  KRBL N^NuNVH0G$n / .S// /.N J.JgBpfBJgBB/HxN`HxN XO B2 L N^NuNV  `HH". L N^NuNVHnBNPOJgHy!dHxN POHxN XON^NuNV/ &nJ0WDf$Hn/ NPOJVDg .0WDHH&_N^NuNVH0&n E/ NXOp*HxHxN\POHxHntBN" HntNXO&@ A\Dg Z_DJgHHм `HHR H@m,@mgZU@glS@g~]@fg@ gS@g(W@fg$@dfgJf / N^XOJgN<`r`p`n/ NXOJgN&`\Jf / NXOJgN`FJf / NXOJgN`0Jf / N>XOJgN`Jf / N`XOJgN`N efJfN hpL N^NuNVH0G$n / .S// /.N.JgBB/HxH0G$n 'n/ Hx4NPO.Jg `$ pL N^NuNV/ G'n'n 'n / Hx5NPO&_N^NuNVH0G$n 'n/ Hx6NbPO.Jg `$ pL N^NuH0/2/ AH@B@2/Ё/@L.Nu//lD//lDa:Jo lDJolD/_.Nu//lD//lDaJo lD/_.Nua.Nua /o.NuJof&/p0/?@0/?@H@?@ NuH$/r2/0/R@eL?A2/?A"/ /2/2/HABAdS@ԯ/@/BLNu/A2/`NV-nHnHxFNPON^NuH $oL /N@QHNXOx/Hy \HxN RnHy dHxNPOB`86xHH  m f|. HH/Hy hHxN RnHy lHxNPO ЅLN^NuNVH0&n$n / NXO&@ A\Dg Z_DJgHHм `HHrsg/ / NPO&@Jg / NVXO&@ gN A\Dg Z_DJgHHм `HHrsfR/./ NrPO&@Jg / NXO&@ L N^NuNVH0E&nB/ NXO&@g* 'fR 'gJfp` \fRJfp` nf p $R` tfp $R`x rfp $R`j bfp$R`\ ffp $R`N 0m< 7n6BB`( 0Inc. 2ZcYyk(d)Pv,||*B EF~NRq0bB$LgLz]j{FbIʌkpEsSh<:r}Wځ?}Ǝgǔ2ylaLI0Hy!HxN POHxN XOL N^NuNVH0E0&y!`~J gv 90oj/+B/N& Hn 90 l 90` <//+/N.JgBB/HxN zHxN XO&S f~J0f/90B/N /NXO/N`XOL N^NuNVH..0l /N(XO&@ k r0 `pLN^NuNVH../NXO&@ k p'@ R0oJ0f#0LN^NuNV 90N^NuNVJ0f#0N^NuNVH0(.,. 0o,90Bo .&y!` f`&S f g$k`fEHx` +&_N^NuNVH0$n &nBBBB  g  g  g  fR` +fR` -fp-@RB A\Dg Z_DJgHHм `HH.p0nr9m0`panrfm Wv``Hx /N П, Ї(RR`Jfp`P A\Dg Z_DJgHHм `HHrhf,R`Jgp` .g"D`"$ L N^NuNVH0&n$n JRgR` L N^NuNV/ &n-KHnHxNtPO&_N^NuNV/ &n-KHnHxNPPO&_N^NuNVH0$n G'n'n'n / HxNPO.Jg `$pL N^NuNVH0$n G'nNB`.Jg S 2 fS`Jg S 2 fS` B2L N^NuNV/ &n  g  g  g  fR` &_N^NuNVHy $HxNPON^NuNVH0E G Hy / /.N Jfp`@NnB 9 Г-@N".o 9 Г`N.o//NPO&`pL N^NuNVH0&nEB/ / NPOJfp`//Hy (HxNpL N^NuNVH0$nG Hy / / N* $@Jfp`tg$HxHy0/ N # Jfr `LN ఓnBHy0/9 9 Г.//N &oN //NPO 9 ѓpL N^NuNVH0EUHHLNu /"/N@UHHNu"_" _N@UHH//N"/ / o "oN@UHHNu@@B @  B@ @ *!~gdnm 7n HH0$`` RRpn` KRHH$` KRHH$l n R` R`4/ / NPPO&@Jg <fl n R`p`` L N^NuNVH0&n$n / NXO&@gHn/ NPO&@Jg$ L N^NuNVH0&nEB/ NJXO&@ +fR` -f~R/ / NPO&@JgpJg D$/ NXO&@ +WDf -WDJg< KR -WDHH.Hn/ N8PO&@JgJg .` .ђ``` g n L N^NuNVH0&nE/ / NPO&@Jg|/ NXO&@ *WDf /WDJgR KR *WDHH.Hn/ NNPO&@  / NPO0lN/B/90N^ HnHx$J/ /90N*JgBB/HxNHxNTXO  o <` &Hn/./. /// N6-@".f$Ԯ ` Ю(`L N^NuNVH0(.,. Ю$@ Ю . n А&@ Ю*o JRf Rf``&F` n L N^NuNVH0..E0 .&y!`f `&S fHxNXO&@JgHxNXO'@Jg'GB &!#!Hx/+NPOld/B/90N Hn  l ` <//+/90N,JgBB/20X (NVH0Nh&n EA C 6 A ,C"gHyN XOp`ZXJf`8`.A C /A/A//N<Jgp`$XJfp`HyHxN dPOHxN XOL N^NuNVH0$n(.BHxHn/ N.JgB/ /HxN .`HnHy0/.N &@Jg//. / N ,/ N\XOpf/ Hy2HxN ~`vHnHyF/.N &@JgDB// Nj / //.N */ NXOg/ HyHHxN ` ~`/ Hy`HxN H ~`/ HytHxN 0 ~/.N:'J'n / HxNPO. n L N^NuNVH0$n G'n'J'n / HxNxPO. n L N^NuNVH0$n G'n'J'n / HxN8PO. n L N^NuNVH0G$n'n'n 'J/ Hx!NPO.Jg `P . SkF n>H0;N$$$$$$$$$*6666**$$ ` + ሀ$pL N^NuNVH0$n G'n'R'n 'n/ HxPNbPO.Jg `$pL N^NuH0/2/ AH@B@2/Ё/@L.Nu//lD//lDa:Jo lDJolD/_.Nu//lD//lDaJo lD/_J@g0+Hr.g`Jg``S'R R @p`,k 0+HrgBB0+H/HxNpL N^NuNVH0&n ..R0+ Hfp`0+ Hg0/0+H/NdPO7@J@g0+Hr.g`` `Jf@HxNXO'@Jg&k &'| R @ `p7@``$k`0+Hr.g`L .ÊҀÊHn // 0+H/N7@J@f&'| R @ `BB0+H/HxNpL N^NuNVB/.HnBNJgp` .N^Nu"/g@ o/4|gSH4H@04<A` Qd`Q@(#)vfile.c 1.2 (1/22/87)*I0  Internal error Usage: Patchbug file file ... rCannot patch "%s" wBad patch of file "%s" Cannot reopen "%s" Cannot reopen "%s" v1Q68010 XPU 151 Patchbug source 1.1 Copyright (c) 1986 Cromemco, Inc. &_& O4"X$IBARAJf0R@@$OSA`QQ C0"OB/ BATAAQ$X&_& O4"X$IBARAJf0R@@$OSA`QSBn C0"OB/ BATAAS@n$XHxNHxNXO `BBHxPHxNHxN|XOL N^NuNVN^NuHop0//NP6N@FNuNVH0..E!\por` X"¼Ё".JgD&R&k* n. Pn Г&@&` R!k fBA `<$&kf м,/N&XO&@Jfp`& X/N6XO`L N^NuNVB/.HnBNJgp` .N^NuNVH0$nYJ!\g y!\&h !\o#!\` !\l o #!\&k` y!\!J%K&y!\ Гf k ѓ k'h`&k Гf k ѓ k'h`#!\` #!\%JL N^NuNVXO L N^NuNVH0&n$n |BB`.2xf$ .SoR`pf ",B`p`,`BRSJm R @p`/ NXO(Jl L N^NuNVN^NuHop0//NP6N@FNuNVH&nJk gP/ NXO.0+ HgHx/+N8POBBk pH'@2+H/NBXOJgp` `pLN^NuNVB/. HnHxNXN^NuNVH0&n$n Hx/ N*PO rfp7@ ` wfp7@ ``"Hn/.NPOJg`7nB `Bk pL N^NuNVH0$n&nB`8SJm R @"JRp`/ JRp/NPOrf`R m L N^NuNV/ &n.Nua.Nua /o.NuJof&/p0/?@0/?@H@?@ NuH$/r2/0/R@eL?A2/?A"/ /2/2/HABAdS@ԯ/@/BLNu/A2/`NV-nHnHxFNPON^NuH $oL /N@QHUHHLNu /"/N@UHHNu"_" _N@UHH//N"/ / o "oN@UHHNu @ @ @@@Nu$/ gL o"o02 |f|g `&|g SrB`"Qd$`QdNu$/ g o"o`QNu"/g8 o4|gS4<A` Qd`QNuNVH0$n G'n'n'n / Hx NPO.Jg `$pL N^NuNVH0&n E%n/ Hx NPO.Jg `&pL N^NuNV-nHnHx NPON^NuNVH0&n E%n/ HxNrPO.Jg `& pL N^NuNV/ G'n'n 'n / HxN0PO&_N^NuNVH0$n G'n'J'n / HxNPO. n L N^Nu./bin/patchbug.bin 7442 77777 77777 6756 4007606255 7634 0./bin/priv.bin 7442 0 0 7110 4007606270 6467 0N^Nu"/g@ o/4|gSH4H@04<A` Qd`QNu$/ gL o"o02 |f|g `&|g SrB`"Qd$`QdNu$/ g o"o`QNu"/g8 o4|gS4<A` Qd`QNuNVH0$n G'n'n'n / Hx NPO.Jg `$pL N^NuNV-nHnHx NtPON^NuNV-nHnHx NXPON^NuNV/ G'n'n 'n / HxN,PO&_N^NuNVH0G$n'n'n / HxNPO.Jg `$ pL N^NuNVH0$n G'n0+ Hgpf"+ B`/ N"XO/./. 0+H/N &_N^NuNVH0&n0+ Hfp`0+ Hgp`tJfp`j$k`20+Hr.gBB0+H/HxNp`< .ÊҀÊHn // 0+H/N*7@J@f&'|pL N^NuNVH,... l D. D,///.Nl Jgp`Hn/.NPOJgp` .LN^NuNVH0&nER0+ Hfp`0+ Hg./ 0+H/NPO7@J@g0+Hr.g`~` `Jf"HxNXO'@Jgk `p7@`N/ Hx&/+0+H/N7@ @@ D@@@@D AD ` n? %lx %l,d. %08lx: %02lx %08lx: %02lx %lc @(#)patch.c 1.2 (1/22/87) - &1Q68010 XPU 151 Patch source 1.2 Copyright (c) 1986 Cromemco, Inc. !@Must be ordinary file or block device NVH0$n G'n'J'n / HxNPO. n L N^NuNVH0&n E%n/ HxNPO.Jg `pL N^NuNVH0$n G'n'R'n 'n/ HxPN:PO.Jg `$pL N^NuNV-nHnHxFNPON^NuH $oL /N@QHUHHLNu /"/N@UHHNu"_" _N@UHH//N"/ / o "oN@UHHNu@@  2 4 8NVH0ND&n BHxBN 6 .Jg`N.Jg `BHxHxN .Jg`BHxBN .Jg`~pf8Hy//N HyHxHxN HyN vXO.`>A$H#$X`Hy,// NvPO/NnPO$@XJfHyN 6XO.BB/HxN  L N^NuNVtH0EtBB/ Hy.N>.Jf~HxHn/N^ .Jf6HxA&H/HnN ro`Hy:/N0POJf``/N(XOpfHyBHxN jPO~Jf /+N*XO.JoBHy./HxN X L N^Nu./bin/ramdisk.bin 7400 77777 77777 6064 4007606306 7450 02HH.p WDf r WDfp WDfp WDJf`S` B2pL N^NuNVH0*. &nJg *g ;fp`B Ю,g  g  g  g  fR`$Kg :gR` l$ + g + g + g + fS`S FB E R" ! // /N g :gR`gR```b E B L N^NuNVH0&n $n .SJggrt `RR`pL N^NuNVH0&n$n JRgR` L N^Nu"/g@ o/4|gSH4H@04<A` Qd`QNu$/ gL o"o02 |f|g `&NNPO/NFPO .L N^NuNVN^NuNVH0| n $p" g JR -fgR -f`J*WDHH* JRHH.JgtpA_Dg rZ\DJg м ` .&n`Jf`J\HHfJg`6J+fp'@`Jg n R'pJf` `~`< `pL N^NuNV/ &nHH g\` +&_N^NuNVH0$n &nBBBB  g  g  g  fR` +fR` -fp-@RB A\Dg Z_DJgHHм `HH.p0nr9m0`panrfm Wv``Hx /N П, Ї(RR`Jfp`P A\Dg   /etc/passwdsystemCannot find privileged user Password: Invalid password @(#)priv.c 1.6 (11/7/86)shell-z-hpriv[%d]shell-cq1Q68010 XPU 151 Priv source 1.6 Copyright (c) 1986 Cromemco, Inc. 2ZcYyk(d)Pv,||*B EF~NRq0bB$LgLz]j{FbIʌkpEsSh<:r}Wځ?}Ǝgǔ2ylaL n p r t v x"/ / o "oN@UHHNu@ B PpcdsrUsage: Ramdisk {-c # | -d | -s | -r} device ... Not ram device: %s @(#)ramdisk.c 1.3 (11/17/86)1Q68010 XPU 151 Ramdisk source 1.3 Copyright (c) 1986 Cromemco, Inc. r/etc/passwd/dev/@DNV|H0E|&nJfp`HyHxBHxBNHy`HxNPOHx/ BNz .HyHxHxHxBNHylHxNPOJfJgJgBB/HxNp`$/ / NPOJgp`HynHxNnPOpL N^NuNVH0$n &n` Jfp`jRR A\Dg Z_DJgHHм `HHHHg A\Dg Z_DJgHHм `HHHHL N^NuNVN^NuHop0//NP6N@FNuNVH0G$n B` n 0 xo nxx``Rp n R R B3xHn/ N*POHx/ HnNJ Jfp`pL N^Nu2 L NVH0N\&n E/ / NPO-@Jg ËҀË``Hxc/ NPO,Jg,Hy&/NPOJgBA&/HxN ````>Hxd/ NXPOJg~`*Hxs/ NDPOJg~`Hxr/ N0POJg~`` Jf`` //N,POXJf 9"`Hy*HxNPOpL N^NuNVlH0GxE/./ NdPOHxHx/ / N2.JgB/ /HxNp#"`HntHx/N, ptfHntHx/ND ptf". gSg"Sg.SfHg8-y&pHnl/NPO.`.Hnl/NPO.`Hnl/NPO.`Hnl/N8PO|g SrB`"Qd$`QdNu$/ g o"o`QNu"/g8 o4|gS4<A` Qd`QNuNVH0$n G'n'n'n / Hx N:PO.Jg `$pL N^NuNV-nHnHx NPON^NuNVH0$nG'n'n 'n 'n/ HxNPO.Jg `$ pL N^NuNVH0$n G'n'J'n / HxNPO. n L N^NuNV/ G'n'n 'n / Hx5NPPO&_N^NuNVH0G..$n Joplp"`p'GA f SA"0` "'A/ Hx@ Z_DJgHHм `HHrhf,R`Jgp` .g"D`"$ L N^NuNVH0&n$n JRgR` L N^NuNVH0$n G'n'n'n / Hx N PO.Jg `$pL N^NuNV-nHnHx NPON^NuNVH0G$n'n'n / HxNPO.Jg `$ pL N^NuNVH0$nG'n'n 'n 'n/ HxN`PO.Jg `$ pL N^NuNVH0$n G'n'J'n / HxNPO. n L N^NuNVH0G$n'n'n 'J/ Hx!NPO.Jg `P . SkF n>H0;N$$$$ z |Unexpected signal number %ld HLsh-csh-cNVH0&n $n/ N(XO.Hn/NPO/ HnNPOL N^NuNVH0$n&JzBx `` KRHH.pA_Dg rZ\DJg м ` . , VDHH  n&J *gzSJf L N^NuNVH&n BBB`,Jl, A<"0ӓcRA  Rp nLN^NuNVH0&n$n (p*B` *pA  Rpn~`( ,pora`p" Ёx (SJl~`( ,pora`p" Ёx *SpoB*L N^NuNVN^NuNVH0G$n / S// /.NX,Jg `LJg@ S.Jg pgB/ /HxNp#"`/ Hy\HxN p#"`B/ HxHxNp#"/NZXOL N^NuNVH&n B/+/ BN.JfHnB/ Hx/.Nr. LN^NuNV/ &n HnB/ Hx~/.ND&_N^NuNVH&n HnB/ Hx~/.N.JfHnB/ Hx/.N. LN^NuNVHBHnHxHn/.N.pf`Jg|` LN^NuNVN^NuHop0//NP6N@FNuNVH0&n E`RRg4 A\Dg Z_DJgHHм `HHHHgg . ` /Hy/.NPO,Jg `2 n-H SA"+fCn ` + n pL N^NuNV/ &n-KHnHxINPO&_N^NuNVN^NuBH />A/N XLDXNuaaaaaaaaNV/.HyHxNl HxNXON^NuNV-nHnHxFNPON^NuH $oL /N@QHUHHLNu /"/N@UHHNu"_" _N@UHH//N"/ / o "oN@UHHNu  @ $$$$$*6666**$$ ` + ሀ$pL N^NuNVH0$n G'n'R'n 'n/ HxPNFPO.Jg `$pL N^NuH0/2/ AH@B@2/Ё/@L.Nu//lD//lDa:Jo lDJolD/_.Nu//lD//lDaJo lD/_.Nua.Nua /o.NuJof&/p0/?@0/?@H@?@ NuH$/r2/0/R@eL?A2/?A"/ /2/2/HABAdS@ԯ/@/BLNu/A2/`H $oL /N@QHUHHLNu /"/N@UHHNu"_" _N@UHH//N! ./bin/rcopy.bin 7400 77777 77777 30107 4007606342 7165 029@ f rªgR`%y@J0Zg 90Z0RR-@`-y0f .l-@`" .Ю谮o .-@`-n%n%nHnB/ Hx/9@N`&Jg"pgBB/HxNB1`J0nf * .䐪.Jf`ZRJg/.Hy5/9@\N J0rg`*J0ng`(J1g|Hn//9@/9@ ND'@Jg6pg.Hy5HxN@POBB/+HxNFB1`J0jg/.Hx/9@ N `Bj%y@-j**HnBHjHx/9@ N$'@Jg6pg.Hy5HxNPOB@B fp` Hy2/ NPOJf Bp#1Hy2/91NPO`BB/ / N.JgB/ /HxN^p`HnHx/N pgrf/ Hy2HxN p`n/ /91NPO#@Lpf2Hy@THx/N HnB/N pgN`Hy@THx /NR p#1pL N^NuNVH0&nEBJ0rgp` fp`Hy2/ N|POJf^J0jg&Hy2HxN8POHy2HxN(POp`Hp#@ #1Hy3$/91NPOp#@\r `p#@\/ Hx/ N .Jf,pg rgtf/ Hy3,HxN PO`Hy6/9@\NPO/91Hy6/9@\N~ 91gr`p" ` +rfp`pL N^NuNVH0GE:BHnHx/9@N 8 HnHx/9@ N " .gHy6HxNPOp`rJ0vVDf J0zVDHH-@r29@t49@//N -_../N\XO#@Jf/Hy6HxN p` J0jfJ0ng`/N"XO#@JfN/9@N.HxN ./NXO#@Jg/NXO#@JfHy7HxNPOp`Jg/Hy76/9@\N p@'y@Bk BkB`B`7C7C 7D7DJfJg*7y@7y@p0+4/NPO A@T"<°/"0/Hy4/N A@JgHy60/9@\NPO`$Hy6@/9@\NPOHy6P/9@\NPO .1J1fJfJg`LZhvHy4/NPO`nHy4(/NPO``Hy4@/NPO`RHy4P/NPO`DHy4f/NPO`6Hy4/NPO`(Hy4/NPO`Hy4/NPO` Hy4/NPOHy`@RmJg4 .,` y@"y@0h1hgB`R .ЅnJg8JgHy7/9@\NPO` Hy7/9@\NPOHy7/9@\NPO .1Rp09@b8Rp09@b"JgHy7/9@\NPOJ0jg`/91Hy7/9@\N J1gHy7/9@\NPO`Hy7/9@\NPOp-@/91Hy7/9@\N .L N^NuNV/ &nHy8PHxN ZPOp+/p+/p0+ R/p0+/p0+ //. pA7/0Hy8HxN $&_N^NuNVN^NuHop0//NP6N@FNuNVH0| n $p" g JR -fgR -! H0$n G'n'n'n / HxNFPO.Jg `$pL N^NuNVH0$n G'n'n'n / Hx NPO.Jg `$pL N^NuNV/ G'n'n 'n / HxNPO&_N^NuNVH0G$n'n'n / HxNPO.Jg `$ pL N^NuNVH0$nG'n'n 'n 'n/ HxN@PO.Jg `$ pL N^NuNVH0$n G'n'J'n / HxNPO. n L N^NuNVH0$n G'n'J'n / HxNPO. n L N^NuNVH0G$n'n'n 'J/ Hx N|PO.Jg `P ."%s". 8n8v8|88888CFLOP %s error, Unit %ld, Side %ld, Track %ld, Sector %ld, Status %02lx%02lx @(#)rcopy.c 1.17 (1/22/87)selecthomeread addressseekprereadreadwritewrite tracky,1Q68010 XPU 151 Rcopy source 1.17 Copyright (c) 1986 Cromemco, Inc. ########Unexpected signal number %ld P @D@@ @  $ @D@ ! @ !@@" @ A DD  !HB   !$ @$ @ B A B@@ D $@H  I" HH @ @  @A$ @H$$@@$"H"A $ @!B @2 <NVH0N L&. GE2p-@A ./Hy N PO(Jg  ր`` pg`Hy#"Hy "HxN Hn C/NPO#2rf `Hy0Hx/92N  #2Jg`p0g r0gt0g p 0fp 0gTr®tgHHy &HxNPOp0fHy >/NPO`Hy DHxNPOHy HHxNPOp`ZHxa/N \POJg(/92NxXOrfHy RHxNPOp#0`$Hxa/N "POJgHy vHxNPOp`Hxt/N POJgp#2HnBHy0Hx /92N ce: "%s" Output file: device: "%s" Type: Cromemco small floppy Cromemco large floppy STDC hard disk Fixed SMD hard disk Removable SMD hard disk Uniform floppy disk System memory RAM disk Floppy tape Major/Minor (%ld,%ld) Size %l,d bytes From block %ld to block %ld , %ld block(s) From block %ld Ordinary file Residence (%ld,%ld) Size %l,d bytes Not enough memory for buffer of %l,d bytes. Cannot allocate both buffers Buffer size: %l,d bytes. p+/p+// p0+ /p0+/p0+ /Hy!HxN `TpA!$pp+/p+// p0+ R/p0+/p0+ /Hy!HxN H Rk p090r2+ 7@J@g`p#2pL N^NuNVH0&nEHy"D/ N>POB`D 3Ax\Dg 3Zx_DJg3xHHм `3xHH2xHHg[`Rpn Z/ Z/NPOBBHn/ N#2Jg`&/. Hx/.Nr #2Jg` .`B/ /92HxN VpL N^NuNVH0$n&n B`&p0* 2Hfp0*2+Hfp`RXpxo JSfJkfpL N^NuNV SkF n>H0;N$$$$$$$$$*6666**$$ ` + ሀ$pL N^NuNVH0G$n'n'n 'J/ Hx!NPO.Jg `P . SkF n>H0;N$$$$$$$$$*6666**$$ ` + ሀ$pL N^NuNVH0G..$n Joplp"`p'GA. f SA94"0` "'A/ Hx@N2PO,Jg `2 n-H SA94"+fC ` + n pL N^NuNVH0$n G'n'R'n 'n/ HxPNPO.Jg `$pL N^NuNVHnHxRNPON^NuH0/2/ AH@UU*I@` 0 t8Rbdeflscvtprx 01Write on floppy tape cannot be verified. (Use the compare opti#2Jg`Bp090S%@B2p090S#2 Hxc/N PO,JgXHx/ /N8 #2J2f`$p2f%R *mp090dHy HxNPOp`(Hxh/N *PO,JgjHxHy2/N #2J2f`2p2f #22 92 2mr2902 dHy HxNPOp`Hxl/NPO,Jg4HxHn/NP #2J2fHy HxNPOp`fp0A2 #0J2f /*//92 /92Hy /NB`J2f/Hy!HxN 90QfR 9230 `230`Nrf`Ry0p090c Read buffer: %ld , compare buffer: %ld, write buffer: %ld , (%l,d bytes) compared OK compare FAILED Swath size (%ld blocks) reached "%s" matches is shorter than doesn't match matches doesn't match "%s". Floppy disks are not the same type Not enough memory for buffer of %l,d bytes. Cannot allocate buffers Buffer size: %l,d bytes. %s - side %1ld, cylinder %2ld %s - side %1ld, cylinder %2ld compared OK compare FAILED "%s" matches doesn't match H0G..EBnp 0gXr{44H/B/Nz rf `HnHxHn/Nrf `p.r2fp`p(pj42H/B/N" rf `HnHxHn/Nrf `pp42H/B/N rf `HnHx/ /Nzrf `bB`Np 0g2H/B/N rf `2/ /NrPOrf `p f` p: A0 r1/ /N*POrf ` A0 "Ht҂1XR`0H/B/N rf `/ /NPOrf `p f`p A0 r1/ /B@2/Ё/@L.Nu//lD//lDa:Jo lDJolD/_.Nu//lD//lDaJo lD/_.Nua.Nua /o.NuJof&/p0/?@0/?@H@?@ NuH$/r2/0/R@eL?A2/?A"/ /2/2/HABAdS@ԯ/@/BLNu/A2/`NVN^NuBH />A/NxXLDXNuaaaaaaaaNV-nHnHxFNPON^NuH $oL /N@QHUHHLNu /"/N@UHHNu"_" _N@UHH//N"/ / o "oN@UHHNuD"./bin/readall.bin 7400 77777 77777 13014 4007606363 7436 0on instead). Usage: rcopy [-b #] [-d #] [-e #] [-l #] [-s #] [-cfprtv] Verify and Compare options cannot both be selected Bad argument for option -%lc Rcopy interrupted. -STDINFile "%s" not ordinary or block device file. -Using STDOUT as output is incompatible with the the verify option selected. STDOUTFile "%s" not ordinary or block device file. File %s already exists. File "%s" should exist to be compared. Device %s should not be mounted Input file: deviRy0 p090 2 c`N30`6 9230 `Nrf`pRy0 p090 2 cRy0p090cRm4J2fHy!&HxNPO/92NXO 92`*Hy!(HxNPOp`BB/92HxN 0pL N^NuNVH0G0 90Ufp7@`7y0J0VDgHy0 / NPOJVDJfBk J2f"p0+/p0+ /Hy"8HxN HnB/ Hx/92N#2Jgr `JJfp`@p0fHrA!$pr+/r+// r2+/r2+ /Hy!`/N `p 0gr0g t0fPpSA" $p" NPOrf `L A0 r1/ /N|POrf `& A0 rpPRR0.HnpL N^NuNVN^NuHop0//NP6N@FNuNVH0$n &nBlF RHr/ NFPO&@Jg. ,fR  g  g  g  fR`Jf ``pL N^NuNVH0| n $p" g JR -fgR -f`J*WDHH* JRHH.JgtpA_Dg rZ\DJg м ` .&n`Jf`J\HHfJg`6J+fp'@`Jg n R'pJf` `~`< `pL N^NuNV/ &nHH g\` +&_N^NuNVH0$n  Rfile (Receive binary file) version 00.10 Copyright (c) 1980, 1982 Cromemco, Inc. Rfile version 00.10 Summary: rfile [-fqw] [-d device-name] [-b baudrate] destination-directory 1b :@3 "i: *- |( ͺ ͊ u :s(  !' F> :s(͂ Ó :@=(`2 *Bt Pq͌f͌d͌ʪb͌n͌Al͌dp͌ʇw͌*h͌((ͷ!8Illegal argument: "%s" Baudrate missing Device-name missing Login-name missinf&/p0/?@0/?@H@?@ NuH$/r2/0/R@eL?A2/?A"/ /2/2/HABAdS@ԯ/@/BLNu/A2/`H $oL /N@QHUHHLNu /"/N@UHHNu"_" _N@UHH//N"/ / o "oN@UHHNuBB@ @ $$! D$"D"@@ @@!@ʍ_ >! ( ( ʍw#60O>y>>O yͷy/  / _/ o/ g"3 * E(D(>ͷ>* " ! " ( [1 *3 7R(#} >ͷ>>ͷ* " *  7?RʽS ! " >Hý((( ((>+m c* w? #" ` 7?R>+m / cG>+m c ** E(D(>>͒8 :% 7G >2% :s :' >> >>> >:% G * R:' y! > :' !5 !0J ./bin/root.bin 7442 77777 77777 2467 4007606375 7020 0&nBBBB  g  g  g  fR` +fR` -fp-@RB A\Dg Z_DJgHHм `HH.p0nr9m0`panrfm Wv``Hx /N П, Ї(RR`Jfp`P A\Dg Z_DJgHHм `HHrhf,R`Jgp` .g"D`"$ L N^NuNVH0&n$n JRgR` L N^NuNVH0$n G'n'n'n / Hx N*PO.Jg `$pL N^NuNV-nHnHx NPON^NuNV/ G'n'n 'n / HxNPO&_N^NuNVH0G$n'n'n / HxNPOg Phone-number missing Password missing Illegal baudrate: "%s" Wrong number of arguments nf~- ##!"*|( #~#(ͦ(<~A[ ~#nf##: =2 *#"# !v !F!J !_( >2sE>2sÎ( >2rE>2rÎ( >2qE>2qÎ t((ͷ"kÎ!â t((ͷ"mÎ!â t((ͷ"oÎ!â t((ͷ"- Î!â t(!(ͷ~ 2( Î!1â!â3 :"Jachlt%s Must use device 31 for STDCSMD drives Cannot read alternate track table -a option only valid on hard disks Bad cylinder numbers Bad head numbers Bad number of loops Reading surfaces %ld-%ld on cylinders %ld-%ld Pass %4ld Surface Cylinder Usage: Readall [-at] [-c #[,#]] [-h #[,#]] devname Surface %2ld, cylinder %3ld, %s error %02lx %02lx Surface %2ld, cylinder %3ld, sector %2ld, %12s error %02lx %02lx @*1 #"1 :s:' !u !" !" * O " * O " Oy)j ,m˭ dˤ !B!& F â!  ! 8d:& G!& F:, ( ڲ W8I:) W8=:* W81:+ W8%!B8!/ ~( !F> Ó !/ ~(!F Receiving from . into Final checksum indicates POSSIBLE error in file reception. Block Count = %d Input data buffer overflow -- transmitted block too long -- Connection lost -- ABORT RFILE "" is an illegal argu./bin/rfile.bin 7442 77777 77777 5542 4016211521 7114 02 (:NVDH0N8EHHnHx A&H/Nx .Jg`BBHnA&H/N.Jg`HnHx Hn/.N.JfNHn/ NPOHnHx/ N Jf*pf"HnHx/ N Jf .f``/.NvXOJf/ Hy HxN p`.pfHyHxNlPOp`B/ /HxNppL N^NuNVDN^NuHop0//NP6N@FNuNVH0&n E`RRg4 A\Dg Z_DJgHHм `HHHHgg . ` /Hy/.N"PO/NPO .L N^NuNVN^Nu.Jg `$ pL N^NuNVH0$nG'n'n 'n 'n/ HxNPPO.Jg `$ pL N^NuNVH0$n G'n'J'n / HxN PO. n L N^NuNVH0&n E%n/ HxNPO.Jg `pL N^NuNVH0G$n'n'n 'J/ Hx!NPO.Jg `P . SkF n>H0;N$$$$$$$$$*6666**$$ ` + ሀ$pL N^NuH0/2/ AH@B@2/Ё/@L.Nu//lD//lDa:Jo lDJolD/_.Nu//lD//lDaJo lD/_.Nua.Nua /o.NuJo f>2 #~4f> 4 #~8f> 9 #~6f> 1#~9 #~2f>2 f> 5 k>1k>#~0#~0#~!@!u@:q ͬ:& G7?!  Ó !@!<C!/ *i*-  0  !  0*- 7x2& 2' :r(A! x2% ! x2% :s :' ! ! ! ! ! !! *- |(!( !* *i! !  ß! !& F:( ~(Wz2, z2) z2*  z2+ !& F !' F ( ! * " !"1 ! " "h"p"v"""""""""""""### %17ld,%9ld /dev/@(#)readall.c 1.11 (1/22/87)selectseekprimitive readprimitive writeprimitive transferselecthomeread addressseekprereadreadwritewrite trackselecthomeseekreadwriteselect head1Q68010 XPU 151 Readall source 1.11 Copyright (c) 1986 Cromemco, Inc. Iment Waiting for phone call ... ~/dev/" NVH0&n$n JRgR` L N^NuNVH0$n G'n'n'n / Hx N PO.Jg `$pL N^NuNV-nHnHx NPON^NuNVH0$n G'n'J'n / HxNPO. n L N^NuNVH0G$n'n'n 'J/ Hx NhPO.Jg `P . SkF n>H0;N$$$$$$$$$*6666**$$ ` + ሀ$pL N^NuH $oL /N@QHUHHLNu /"/N@UHHNu"_" _N@UHH//N"/ / o "oN@UHHNu@@ Nb$@Jg:pRLf / / /"AA/0NZ&@`AB(#R``AB(#R`z L N^NuNVH0N&@ gpRfp &` R =fp&`p&`R R &fp&`p&`R R |fp&`p&`R R =fp&`tp&AB#R`^p&`\p&`Vp&`Pp&`Jp&`Dp&`>p &`8p &`2p&`,p&`&p&` p&`B`p&AB#R` `R L N^NuNVtH0E` JRRR, yR, A\Dg yR, Z_DJg yR,HHм ` yR,HH.pa_Dg rz\Dfp0_Dg r9\Dfp_WDJfxBGC` JgHn/NPOJfJfp#R k ( k"('@`$ k ( k"('@` k "k (]DHH'@` k "k (_DHH'@` k "k (^DHH'@` k "k (\DHH'@` k "k (WDHH'@`j k "k (VDHH'@`L k "k )'@`6 k "k )"('@` k "k )'@`/ NXO&_N^NuNV/ &n0+HrfB/+ N8XO k JVDHH'@Jg/+NXO kJVDHH'@`/ NxXO&_N^NuNV/ &n0+HrfB/+ NXO k JVDHH'@Jf/+NXO kJVDH  0//dev%s Root device not found in /dev @(#)root.c 1.3 (1/22/87)O1Q68010 XPU 151 Root source 1.3 Copyright (c) 1986 Cromemco, Inc. r/etc/passwd/dev/sh-csh-c`BBHxBNr&@'yRHp#RLN`BBHxBNH&@'yR8p#RLN`NBB/9RD/9BN&@p#RL`NBB/9RD/9BN&@p#RL`p.9RDNrfHNN&@Jg:B/ //9BN&@p#RLrRNb]DHH.`Z_DHH.`J./bin/scan.bin 7442 77777 77777 36744 4007606462 7003 0#R`AB#R L N^NuNV/ N&@JgpRLgAB(#R &_N^NuNV/ N&@JgpRLgABD#R &_N^NuNVH0$nHxNXO&@&7n'n 'n L N^NuNVN^NuNVH0ER,GR< R  g R  g R  g R  fR` R Am R Zo R am R zo R _f N&` R 0m R 9n N &` RH@mt@mgv@gU@fg@@=kx @npH0;NVLff8f ,>\Df2ffffffffffVfpP@!f gN&`$R R =fp&`p&` R R <g/ / Hx/9AN r&@`` L N^NuNVH0N&@JgJpRZv:Zx k "k/(/)N'_` k /( k/(N'_` k /( k/(N'_`n k "k )Ш'@`V k "k ('@# ^DHH.`:\DHH.`*fJWDHH.`fHH.`/NXO F!GL N^NuNVH&n/+ N6.N.XO k /(N0XO. k/(N XO, ІR/NXO'@/ k /(/+N / k/( Ы/N k ІB0LN^NuNV/ &n0+S@gS@gS@gS@f*g'yR0`&'yR`'yR(`'yR`/ NXO&_N^NuNVH0E,.&yR$ F0([@k @nH0;N$0<NZfr~p0+.`dp0+.`Xp+.`Fp+.`:p+.`.p+.`"p+.`.+`p0+.gR` L N^NuNVH&np<,p+.rc  S`WHxm/N& П"Ёr+ЁAFr0x*/<Q/Np+Пr+t+HxPOHnHx/.Hx/9R@NprASDg ptZTDJg pм `pryWDHH.`/NXO F!GL N^NuNVH&n/+ NvXO0+@k @nH0;NV2 k /(HyFHxN p'@` k /(HyFHxNd p'@` k #FxBBHnHyFpN$.Jg`xHnHnHnBN.Jg`Z'n`P/9R k /(NPO ѓ k'h`&k Гf k ѓ k'h`#F` #F%JL N^NuNVN^Nu"/g@ o/4|gSH4H@04<A` Qd`QNu$/ gL o"o02 |f|g `&|g SrB`"Qd$`QdNu$/ g o"o`QNu"/g8 o4|gS4<A` Qd`QNuNVH0$n G'n'n'n / Hx N:PO.Jg `$pL N^NuNV-nHnHx NPON^NuNVH0$nG'n'n 'n 'n/ HxNPO.Jg `$ pL N^Nu\Dg Z_DJgHHм `HH-@ A\Dg Z_DJgHHм `HH".gb A\Dg Z_DJgHHм `HH-@ A\Dg Z_DJgHHм `HH". ` RRf6pL N^NuNVN^NuHop0//NP6N@FNuNVhH0BBBHn/.N @JfHxHnl/.N JfHxHnlHnlN rnhHn/.tNfPOJgVHx/.lN PO,/NBXO$@Jg8Hx N2XO&@Jg //.l/ N  7n'J&. `/ NXO`b/.N XO/NvXOL N^NuNVH0G$n / S// /.N ,f&/p0/?@0/?@H@?@ NuH$/r2/0/R@eL?A2/?A"/ /2/2/HABAdS@ԯ/@/BLNu/A2/`NV-nHnHxFNPON^NuH $oL /N@QHUHHLNu /"/N@UHHNu"_" _N@UHH//N"/ / o "oN@UHHNu @  D @B B@$   HB @ H H H@$HBHH ``"pfB/.NXOBJgpgBHyRP/HxN ~ L N^NuNVN^NuNVH0$n &n` Jfp`RRgHHHHL N^NuNVH&n~` KRpf ` R o . LN^NuNVH0$n &nBBBB  g  g  g  fR` +fR` -fp-@RB A\Dg Z_DJgHHм `HH.p0nr9m0`panrfm Wv``Hx /N П, Ї(RR`Jfp`P A\Dg Z_DJgHHм `HHrhf,R`Jgp` .g"D`"$ L N^NuNVH0&n$n JR<<<$H4Integer expression expectedString expression expected':' expected',' expectedMismatched types')' expected'(' expectedUnexpected symbol@(#)compile.c 1.5 (1/19/87)EUnrecognized symbolIllegal stringE,E6E@EHEREZEbEjErEzQEEE'@`6/9R k /(NPO'@` k /(NXO'@`/ NXO`BB/HxNHxNBXOLN^NuNV/ &n/+ N(XO0+@gS@f6g/9R k /(NtPO'@`"/9R k /(NZPO'@`/ N\XO&_N^NuNV/ &n/+ N.NXO0+@f k/( k /(NH0;N$$$$$$$$$*6666**$$ ` + ሀ$pL N^NuNVH0&nE/ Hx0NPO.Jg `j jjpL N^NuNVH0E&n/ Hx2NPO.Jg `jJg `LJg@ S2HH.p WDf r WDfp WDfp WDJf`S` B2pL N^NuNVH0*. &nJg *g ;fp`B Ю,g  g  g  g  fR`$Kg :gR` l$ + g + g + g + fS`S FB E R" ! // /N g :gR`gR```b E B L N^NuNVH0&n g .&$K&G` L N^NuNVH0| n $p" g JR -fgR -f`J*WDHH* JRHH.JgtpA_Dg rZ\DJg м ` .&n`Jf`J\HHfJ@" BB@ $@IB ( @!@@@ @ @H@@@# EEEEEE E E E E EEEEEEFFF FFF$F*F2F: FD FN!FV"F^" Fh"!@(#)scanner.c 1.5 (1/19/87)is_ordinis_directis_charis_blockis_pipeac_readac_execac_writac_apnddayspathdirnameextowne }(&o(E\(: (al ̍*t:*"* 2 u[t: } &(8}!*5( }/8} !u~O~> (8> l~y0Insert: u:t_:=:)W+J*[*0~#0=( >[Rr([U+͌ (5O(}\(*($o(&  (.H!U+q6}  ͌ ܌͌~͌ yɧ}͜ 8} 8o(8A8 [8 a8{8/7F ! ( ! ^I^M!S)}Q(q `3CROMIX Screen Editor version 01.51 Copyright (c) 1980, 1981, 1982 Cromemco, Inc. 1! ̀2*2)<2*>>2 yEHCAKJFZZlmPLM  !ͭ({ z Str:t(͐:uͥ!ͭ(2u2tr!ͭ2u2t> 2ù>:t> :u6 : >&:)O?*\:)*(?O:*(yO!!*6!(=E0, !!}_Y 8u0Write: to already exists. Delete it? (y/n) !J !9 8>  !*6!9 0!B!(- % !*/dev/prtError: List: !m 8̀8Read: >2*:*7:*W N2*!RDM!U+T]~# (* :* %> 2*!d) y *f)|Ļ$>ߗ2*2*!U+8 BKA@@@xO( :A: EXit will return to Screen Hshell!\4~!È!!͈ !͈ !I͈ !e%+}@! /!x(=( !ò"!"!"͆0@RCQUContinue Quit Update Continue - update and continue editing Quit - exit without updating Update - update and exit - return to editor >Exit: Continue Quit Screen aborted Update : >( (Z % p&(z % O:*22% : >(:&8(e!*ͺ0 }((!i!*5 48/*!iͺ0!u:*O> y !i!e!*:4( ̍5&0:*0<<N(q=7GN1?!:rO0>{>> !\0!rͬu!*/set marker At: >>uÛ:rOGPx<8!a!k*uͺuͺɇ!s !͛Jump: !͛͛8Zap: !Y!Q!`!e9!>,ͺ Ͳ\8rgrouptypeaowneragroupaothernlinkssizeinodeparentdcountusagetcreatetmodifytaccesstdumpedokshellusernumgroupnumprintprintnstrlenusernamegroupnamestrequgetusergetgroupnowFFF%s %s%08lx: %08lx %04ld %08lx %08lx %08lx @(#)interp.c 1.6 (1/19/87)sh-c/            IP|8[t+!>+͜ 8!) 2)>,!U+w ȗ2)%ʛ:)(ʘxʘ:)(T8!JS# Ϳ+( Ϳ+++ͪ }!m /~(0!U+~(x0DF#~**w(G8%0: > &q>; #~l̀:U+(G&Substitute: [Query] , Query :Substitute Query: Yes No YN!S!) 2)2)%(q:)( 0:)8Find: yl[t ̍*t"*z8`:(PW& >22y ( ! !ͭ*t(:t!<(͍(+!ͭ*t:!uG:t +!W!R!M!H!C!>!x_ ( ( 0͌> !t^ (:u :*W+~̿#~ <ŗ *vh)Sv>@2xR(*vw#"v!x5_!4 { 0 >^ͫ{@ͫ!B󀁂 \r(ej}!_( ~#{ y: <28G(x2:8B(2!@::2!ͪ- % $| ͛!U+(2(s83!*ͺ8!*V(ͩ:*G g  !l#!*!T]J abort!* ( N  ( 0 >^͏@w#{̩:(> ͏> :*!RT]!U+!8 :*2*$$$.$$2} (o( 8"!R!R0͌/͖ ([*+!5:?2*\`͍:!*=:==<2*:0[` !R8(w͍:!tw`+V!*5ʹ4[&(>0`(Q[0G0 ͍:*=>2*(&(z % :>(Z % ::(:8:(:G:*<8:(ʹ2͛>:*=(2*: %: > (Z :*% &(8:*=0<% C z %: >  06>(Z %  0O&(z % :_:*!4 #4!w q%(> 2@:*!4 #4!w q%(>  Line(s)>>><2 ͖ (r: :*r! q%(: >(:= @:= Page! ~>>w:u2)! ʹ(!F(20!rͿ0&eu !Q !Y(!`/71234567CBECursor Begin End 1> *ͺ8 ( (& O~ #**[*R(S*!*Nq:R!*$r0З!W ( ( 0 y8O?zɗy**[*R(9:X!*!* (( ($ 055d$[*S*:w0N͊:*?<[*! [*!**R0   x(PY~#z y2*[*8&0G&(&(0  y yG(0./bin/screen.bin 7442 77777 77777 24150 3444700167 7323 0 :($+0} S*O! ~>>w!(\(WO(0 (ʿy (G[*0S*y**+w*t> ()*t(x (:5"*w22 S*l&*tz8:3{ |0> l&"*:*G[*8z8 (S*&[*Xchange: ()''("(2*: > (&!)**[*R|r!*p**[*~(6#*(8("?(\6(:*(**!*F**#8: > <(~(#*(?(\(6 2*"*x2*"*~#*?+>\0 ( ?~#Oɿ(@& .>:8")S)!~4K222>2x*)[)>h>h >}h)@@: 2\!(2!C͉(8 2:Ÿ:!k/Edit: At Copy Delete Exit Find Insert Jump Move Other Page Substitute XchangeEdit: % Beautify Home List Other Read Tabs Verify Write Zap@A%BCDEFHIJLMOPRSTVWXZ <,->.+$s$]p ~l$N Q @K+  6 //!@>Shell:!$3!@!@!@ DH8E8~#:!tG(( ((7:t:*O(0 y2R0͖ (q +4!`+*f[xxxxx!\#(0"0o\0T])))0 !\"O~ȹ(# <,->.+s ͞(% :u2m%( /: > %(͗(! >>G (% G(%  /0:m!u0 /% G/0:u!m0 G/0 $  y A+4 A+5N !**!*͛:eRЗ!9(5[***BR0]!9([*Ͷ![*0!|([*R 8**0 0:̴!9(**Rb"[*8|(**X!8[*0X!0[***[*R(=DM**R(>S*8S* **S*+**B"**B""*"*"*"**[*R*[*RѧRͤ!"*"**"*"*"*"**R<<T]Ú![**R([*RDM[**S*(+S>2**">22./bin/setpri.bin 7442 0 0 3213 4007606472 7021 0 (5!:$ˆV 7**:*G8$CT]::$O~# ( (ˡ!:$qS*!:$7aˡ > ::$O(C**R:*G= (*C[*:(&+~ (S*!:$ (ˮ!:$ˎ7+~ > S*!:$*:(Fnˮ** ([*0d~# ("*!*:*G8>  !:$͏"**[*0$~# > "*!*:*G8͏""**R"*:*G?8͏"!*[*!:$**:*GR8"*͏"!͛Ͷ!0\!#!#3#8!> 3e#!F#8:*(G !:$6:*G!}2*T]Kl D//lDaJo lD/_.Nua.Nua /o.NuJof&/p0/?@0/?@H@?@ NuH$/r2/0/R@eL?A2/?A"/ /2/2/HABAdS@ԯ/@/BLNu/A2/`H $oL /N@QHUHHLNu /"/N@UHHNu"_" _N@UHH//N"/ / o "oN@UHHNu  FUsage: Setpri pid priority Bad process ID: %s Bad priority: %s @(#)setpri.c 1.2 (1/22/87)+!u'|'8Fw:&0O:&0 ( :&0 p/î&Beautify: Paragraph(xxx) Left(xxx) Right(xxx) ͞'ȧ(͞'ȧ(͞'ȗ/o&'4!' :c)( !*> );) (&E)(&ʹ0!*():c)8 <;) &&0&:&!*(a&)([E) !(~/w "Ͷ(&&)(E) )=(6&E)(&) ;)(8E) E)(&)=(&0 )&&(#K)(Z) 2T+0 ) (&)0~G:c)> >  Sfile (send binary file) version 00.09 Copyright (c) 1980, 1982 Cromemco, Inc. Sfile version 00.09 Summary: sfile [-q] [-d device-name] [-b baudrate] [-n phone-number] [-l login-name] [-p password] file-list 1N:@X͸ ^""{:}m/ *n|(> :(y p  *|(Ϳ 1 ( " :}ʸ ʸ 2}*{#<""{/0O:d(y> M :@=(`2}*B Pqʁfʘd/bRnlp**[R[*(@[*R[([*0S*+S*S*SS*SN**[0#P: eN*[*R(I[*R([***R( R(*8%bk+S*(#"*R!***[*RDMbkS*(U3W???! zͿz<!8!:G1>  { > :G>1:8>0<U+! :G ^#> 0>T[t+:G!U+^ \(0 (/ (_T(/7 s#^!U+ @A{wSet Tabs: #!*( 8 2 P QNVH0N`&n EBpg`Hn/+N@POJf`/ /+N,POJg pذnr(l`HnBNPOBHxBN HnHx/.N ,JgBBB/HxNP~`>Jg .fJm/Hx/.N `BBHxHxN~/.HxBNP `FHyHxNPOp`2/+Hy HxN p`/+Hy4HxN pL N^NuNVN^NuHop0//NP6N@FNuNVH0$n &nBBBB  g  g  g  fR` +fR` -fp-@RB A\Dg Z_DJ8x2*!#3̓"**:*G!#:*G(4::$w( 2*8!x2*H:*G 8::$_ b ͍#l :*O:*2*Gy2*::$_ b ͍#**A% %l,d bytes written to: %s Please make space with DELetenew fileScreen [-cn] [] .bak.bin.com.ovr.ovl.rel.obj.o68.sav.$$0.$$1H A;$+w;$+u*ͺd)D$>!$!$2R+-͈8:R+G( ͛1Ԙ̀8Copy: Move: Nʹ*f)EL!U+[*S*!\$9!*d)D$!"f)ɗ2R+2S+!|&Ͳ:S+(+1Q68010 XPU 151 Setpri source 1.2 Copyright (c) 1986 Cromemco, Inc. &**6 **+6 !*6> l!*Nq&8 G:c)!*xͺ "'}]).?!  wʯh(G(<!08Illegal argument: "%s" Baudrate missing Device-name missing Login-name missing Phone-number missing Password missing Illegal baudrate: "%s" Wrong number of arguments nf~- ##!")*)|( #~#(+(<~A[ ~#nf##:}=2}*)#")#y !t !F! !\( >2O>2( >2O>2( >2O>2 (G(<O"!' (G(<O"(0&Ʌo$0?:a{_R*|+"ɗ2t'SSdS S>0 >2t*[*R::$GW <ɗ¿"!#Ϳ!:$6 u*Bnf~- &#~c(C( n(N(>2##nf^VS*|#z 2:$"*ͬ ʿ"::$w  8!z>¿"x2*l ڿ"x2*g ڿ"x2*L ڿ"L |($/$4$** ͎ **#~( /(. T]z bk͎ $>!$ > ~< <~#G~ # !:$F(**:*G=gHHм `HH.p0nr9m0`panrfm Wv``Hx /NT П, Ї(RR`Jfp`P A\Dg Z_DJgHHм `HHrhf,R`Jgp` .g"D`"$ L N^NuNVH0G$n'n'n / Hx(NPO.Jg `$ pL N^NuNV/ G'n'n 'n / Hx)NPO&_N^NuNVH0G$n 'n/ Hx4NvPO.Jg `$ pL N^NuNV/ G'n'n 'n / Hx5N4PO&_N^NuH0/2/ AH@B@2/Ё/@L.Nu//lD//lDa:Jo lDJolD/_.Nu//l[t +!&+\!&W((2S+ͮ&z8!*͛!~:&2 #~4> 4 #~8> 9 #~6> 1#~9 #~2>2 > 5 >1>#~0#~0#~!@!  ͘  ! *!M ! * x2e*n"p 0  !"p 0*n7x2d:dGz2hz2gz2iz2k:f(Wz2j:( !B  :dG> !B*.>(l!_""> x~(͉(~(I x~(#x2!F !oF SIM Illegal options for SIM *|+"*^#V#">2[!"222>222!"ͱ\!z2!1"o!"Y!@+"W|(!@!(@"1R !gz2dwz2ewz2fw*&8c589785* 8N!z> C!!5878 75çCannot set user/group ids 1ͥY2!8-z {>(" >22!"!"K@[BçError during loadi8((N " !"\ g !"t!"v*tI "t*vI "vOy)d ,m˭ dˤ !: ͘  !B!dF! :dG?Sendblk timeout !@!dF> !B͘   !͍ ! :eG0 ! @8@!C89!dF8/[r!8$!@8R(*rR >7:d! :eG : :d> >*#"::d!":dG:dG:j(( W:gW:hW:iW:kW> > ͘ {3*=*?[9K7!}G! 2Illegal CDOS call %02.2xH at address %04.4xH j *3~#fo:7o&ôUnimplemented CDOS call %02.2xH at address %04.4xH F X  / 6 ; e O ` k s A MP P  P H   P P P P P P P Q P P = P P  # x a{ :>8́ŹW0́826.(ñ!~{( (6 .(ñ:G< ! x2826.(ñ/dev/rdr:G< ! x2{.(ñ/dev/pun:G< ! ./bin/sim.bin 7442 0 0 15052 3731336662 6333 0(=2:29=b 0! 0%t!s"r#f n %;u!t"s#͖!%͋ (6.#͋6! (w#(=8:o&)))) !>w!~#<( 7 (  <+F!~<( ;p# F!ڱutsr66666 !F>( ܹ6 ^ &;~ g.;z { | }utsrڱnfNF0utqpnf^Vz {@ | }8@! 0%lc6>!,:dG!B> !98:dG> :d(_*p z(O!@!m@!<C:(!R :dG}}!@R ͘  !B!@:dG*|M M:dGد((7(*~#(> *|:dG~#(> !B:dGد(2*!Bد :* :+(>2x:x!: ͘  !  !  !y 7?!  !x4>!dF!@!Cͽ !@RR(!BR*[~#( ^(/ "l:dG!Z͍ ng of the program ÑÉÑ/b//c//d//e//f//g//h/!F Batch not allowed `i͹F> !R :dW:eW:fW0> !F!F Dialing Transmitting to "" is an illegal argument .Now waiting for call to complete ... No answer -- Sfile aborted  Connection lost -- ABORT SFILE Final checksum indicates POSSIBLE error in file transmission. Excessive transmission errors Block Count = %d Rfile not responding -- Sfile aborted  x2{.(ñ/dev/prt{<ˆ R u > \ :26{2:( $_͈ !~$(#ñR 8![^ >28v(˚́Z^ ́1V(́*9^##8{( +~ ( (#{(6.(R ͹ñ 26 ñ ±ñR >B>8́Ź 0́8.(ñYÈ *÷!"";>"26>28ɯ2!"{26 (b 0(  8Ϳ͹>26    F( 6 ڱ26Sgx2:G!/ 8V:K([͔ ͖!%%!CS* *}:(=G R*+Z~(~w#z +|W]xDM*g[K_ iCDOS SIMULATOR version 02.69 Copyright (c) 1980, 1982 Cromemco, Inc. [BK@SC͉G~- A#~I AQQo&)))) 6͉Q~((w#+~/(#6/#6"[I # **͉(#~/(\~#=(͉(~/(l\!_V :R8| }8>w>w#"Zg!/ 8:K(͔Y±͓!O6#͖!O_Fx<  ڱp !͵ ~(. #͵ ~ ~(.( /( ^(I O#?(N!F"~# !8 p 9q >726>\ *W|SY!z(!@>  ѯ#~+: ~I @8 0##o.  #o! w#w#w#w";#~I !/=,.(*(>?BKS"9BKTS9";>26!i"7bh1ڱ0{27|28}26bh3ڱ2{27|28}262| ~ ~ <[ : :dV ! *!M V ! *!- *n|(!P !M >̀ 8N!Z͍ ͮ O:dy*l> :dG@8! C8ͽ 8!@8R:dG!dF!dFɯ2x2z !~ Cr!~~9 (Y(U(Q(M N>1 #7 4 G:z>n(>1 :z1 >2z)  x9 !z4~( >1 ~) >1 { *}1 |1 *t}|7RSr[r!   (  Ͷ !x4~Ͷ  RͶ z 8B> * *t × } | > *v -4  B 7BM-------!UF Y͑Y͑͑Unimplemented CPM jump at address %04.4xH R !g z(w>çOut of signal stacks sm{o*m*o"oqR|ʙ*Y|(*!@*Y'*o "o"m{m!@:Aôsm{o*m*o"oqR|ʙ*1|($!(@*o "o"m{m!@:Aôs3"="?";S9C71"5y)0F!  !0U! _^#V#*5[9*;*5{3*=*?*;[9K7/dev/22±͓>26:G<2:([! ~?( *!/:=w *[26";!"bk >?#( ͤ b  ;! -*| }8!}26͖!%%! ? 0$$z 80Ĺ*"4 =4 >ݾ ~ <(w 66 ~ ݾw>26( b8R^ !;;z { | }8&utsrF6 [ Ϳ26͹>ͤ b!b!$0Ĺڱ>26:26Sɯ26!";{<% (w 6 Ϳ8[*0 Ĺ>͞>( 6#= %26| [*0 ( ( b͹> > ͞ ѯ%26ɯ26 >? !-26͖!%%! ڱ!%11l,d %-.24s {O_W{/G![~26w^(́V(́~ 2\~2]~ 2^ɷ:\w :]w:^w O{((Fg><><><x<><>.<x<z/!o0$~GgG!o0$^#V#~EHDCABKJbc][iI0PQMLWX12@RSZZgh89      1I<`" ` ` `p`&Rf|R```/9@NxXO#@ L N^NuNVHy0HxNPOHy0RHxNPOHxNBXON^NuNVH0p й0//90 NNXO,&F 90 "Ҁ$AB`& 'P s"s#J "90ЁR0 m/ 90 S/NdPO./ /NPO*J@&f Hy0z/90NPO#@" y@B/ //NJ /NHXOJ@&gNjL N^NuNVH&n B` /3NXOJf`Rm/HxN4,`/// N SJl LN^NuNVH0*.&n $s./ NXOJgJ@&f 9@&R@&/N@XOI$@! "$@""!"BA"HUUUUUUUUUUUUUUUUUT @D H@$@$ DBDA$B! @A$ I $ D"""$HHB  @$"" @A"DD! "H @ AA"@ I$I$!! /90/3"/2N, ".' "3f4"/2N2XOS "%$ A(C ` HsNXOR`|JgB~` Hs"HsNPOJl,Rn HsN XO -@/90/3"/2Np ".' "3f4"/2NvXOS "%$ A(C ` HsNXO`HL N^NuNV/ /.NXO&@Hy0/ NPO#@" y@B/ N&XO&_N^NuNVH0&nE@Jf4 y@Jg&Hy0 9@X@ @/N0PO$Jf``p`4/90//Nr '@ +f /NXOB`/ NXOpL N^Nu2Pp"$#NVH0N,.&n E@/ NrXO.Jg ËҀË`NJg $#@`p$A0#@/90N XO#@J@g/9@/NPO`NpL N^NuNVH0,.~ F &p" g` -fVJ+f`N +-fR`@ +A\Dg +Z_DJg+HHм `+HHrof0J+f* FR Jg F R#0`p`` +A\Dg +Z_DJg+HHм `+HHrlfPJ+fJ FR Jg2Hy0 F R/0NPOJg 90R#0`p`h`J +A\Dg +Z0"pNPO. Dpg D. F E L N^NuNV/ &n9@gg KR9@f```&  g  fR``  g  f`Rf &_N^NuNV/ &nJ g  g  fR` &_N^NuNVH0&n$n ` Jfp`RRgHHHHL N^NuNVH0&n$n `Jfp`RR A\Dg Z_DJgHHм `HH-@ A\Dg Z_DJgHHм `HH".g A\Dg Z_DJgHHм `HH-@ A\Dg Z_DJgHHм `HH". L N^NuNVH0&n$n `  m l`Rf`I=]G2!/!wmglgdg:@<;g~( (<#><Gy0 g><?gGgG, $S&/ N./NzPOJlVSJg, &'`"/9@"N4XO 9@&R@&/NXO./B/ N /// N `/B/ N `V L N^NuNVH0,... &nEJg8/NXOS &S"'/B/ N /// N `/9@"NXOJgD 9@&R@&/NPO&@ fHy0HxNPOHxNXOL N^NuNV/ HxNXXO&@HnNXOHx/.Hy0Hx/.Hy0/ NPO/N /N PO/N &_N^NuNV/ /.NXO&@Jg `BBHxHxNlHxNXO&_N^NuNVH0.. ,.HxNXO$@Hy_DJg+HHм `+HHrnfFJ+f@ FR JVDg Hy0 F R/0NPOJVDJfp``Rg A\Dg Z_DJgHHм `HHm gfUgnSfzg"g$Ug,Ug4WgBHxHn/ N.p7@ ` BHxHn/ N.p7@ `~!B @ 000P1Usage: Sort [-mubdfirt?] [-o path] [-n lines] [-l size] [+x[.y[bdfir]] ...] [file_list] wwwrwrInput lines too long Write error .sort-Cannot open %s pp@(#)sort.c 1.4 (1/22/87)--c|1Q68010 XPU 151 Sort source 1.4 Copyright (c) 1986 Cromemco, HHHL N^NuNVH0&n .ËҀË$KB .SJg&S/. Hx Nr0ҟA /Hx Nr ` L N^NuNVH0$n &nBBBB  g  g  g  fR` +fR` -fp-@RB A\Dg Z_DJgHHм `HH.p0nr9m0`panrfm Wv``Hx /N П, Ї(RR`Jfp`P A\Dg Z_DJgHHм `HHrhf,R`Jgp` .g"D`"$ L N^NuNVH0&n$n JRgR` L N^NuNVH0..E1por` X"¼Ё".JgD&R&k* n. P2 NVH0N&n E/ / NPO-@Jg ËҀË``Jg Jg`Jg"Hy /*NPOJg p o`Jg Hy/*NPOJg po`zJf`tHy$/NDPOJf/+BNtPO.`NBHn/N* .Jg//HxN `& +g +` //.N.PO./.N2XO `Hy&HxN^POpL N^NuNVhH0EG|&. |Jg`@Hx/NPOr}l/~/HxN `p&BJ gHntHx/ /.N.`HntHx/ /.N.JgpfB` /HxPO.Jg `pL N^NuNVH&nHnHx:NPO.Jg `&pLN^NuNVH0$n G'n'R'n 'n/ HxPNbPO.Jg `$pL N^NuH0/2/ AH@B@2/Ё/@L.Nu//lD//lDa:Jo lDJolD/_.Nu//lD//lDaJo lD/_.Nua.Nua /o.NuJof&/p0/?@0/?@H@?@ NuH$/r2/0/R@eL?A2/?A"/ /2/2/HABAdS@ԯ/@/BLNu/A2/`NV-nHnHxFNPON^NuH $oL /N@QHUHHNjPO.Jg `$pL N^NuNVH0$n G'n'n'n / Hx N"PO.Jg `$pL N^NuNV-nHnHx NPON^NuNVH0$n G'n'J'n / HxNPO. n L N^NuNVH0$n G'n'J'n / HxNPO. n L N^NuNVH0$n G'n'J'n / HxN@PO. n L N^NuH0/2/ AH@B@2/Ё/@L.Nu//lD//lDa:Jo lDJolD/_.Nu//lD//lDaJo lD/_.Nua.Nua /o.NuJof&/p0/?@0/?@H@?@ NuHJgBk p` 7nB L N^NuNVH0&n$n Hx/ NPO rfp7@ ` wfp7@ ``"Hn/.NPOJg`7nB `Bk pL N^NuNVH0&n0+ Hfp`0+ Hgp`tJfp`j$k`20+Hr.gBB0+H/HxN Hp`< .ÊҀÊHn // 0+H/N7@J@f&'|pL N^NuNVH0&nER0+ Hfp`0+ Hg./ 0+H/NbPO7@J@g0+Hr.g`~` `Jf"HxNXO'@Jgk `p7@`N/ Hx&/+0+H/N7@J@g0+Hr.g`JgInc. *I@,n Г&@&` R!k fBA `<$&kf м,/N&XO&@Jfp`& X/N6XO`L N^NuNVB/.HnBNJgp` .N^NuNVH0$nYJ1g y1&h 1o#1` 1l o #1&k` y1!J%K&y1 Гf k ѓ k'h`&k Гf k ѓ k'h`#1` #1%JL N^NuNVN^Nu"/g@ o/4|gSH4H@04<A` Qd`QNu$/ gL o"o02 |f|g `&|g SrB`"Qd$`QdNu$/ g oNPO`Jl@ R//HnN // HnN .JgHn/HxNz `XBHnt/.t/ /Nf.Jg/HxNNPO`.R 9 g"9 ` 9"n /NXOp&`Jm/NXO L N^NuNVH0&n$n Hy`/ / NPO/NPO&@/.HxN +/.HxNr +L N^NuNVN^NuHop0//NP6N@FNuNVH0| n $p" g JR -fgR -f`J*WDHH* JRHH.JgtpA_Dg rZ\DJg м ` .&n`Jf`J\HHfJg`6J+fp'@`Jg n R'pJf` LNu /"/N@UHHNu"_" _N@UHH//N"/ / o "oN@UHHNuA$     "A @ A @H@@ @ @@    @@$/r2/0/R@eL?A2/?A"/ /2/2/HABAdS@ԯ/@/BLNu/A2/`H $oL /N@QHUHHLNu /"/N@UHHNu"_" _N@UHH//N"/ / o "oN@UHHNu@ " dfbl-Usage: Split [-f] [-b #] [-l #] input-file [output-file] .aa@(#)split.c 1.1 (12/18/86)``S'R R @p`,k 0+HrgBB0+H/HxN pL N^NuNVH0$n &ngPO.Jg `$pL N^NuNVH0$n G'n'n'n / Hx NPO.Jg `$pL N^NuNVH0&n E%n/ Hx NPO.Jg `&pL N^NuNV-nHnHx NPON^NuNVH0$n G'n'J'n / HxNXPO. n L N^NuNVH0$n G'n'J'n / HxNPO. n L N^NuNVH0&n E%n/ HxN`~`< `pL N^NuNVH0$n &n` Jfp`RRgHHHHL N^NuNVH&n~` KRpf ` R o . LN^NuNVH0$n &nBBBB  g  g  g  fR` +fR` -fp-@RB A\Dg Z_DJgHHм `HH.p0nr9m0`panrfm Wv``Hx /N П, Ї(RR`Jfp`P A\Dg Z_DJgHHм `HHrhf,R`Jgp` .g"D`"$ L N^NuNVH0&n$n JRgR` L N^NuNVH0$n G'n'n'n / Hx& 1Q68010 XPU 151 Split source 1.1 Copyright (c) 1986 Cromemco, Inc. p`g[gSJm R @p ` / Hx NPO`/ NXO`/ NXO/ NXOSJm R @p`/ NXO.rg.p g(SJm R @ ` / /N8PO`` `nSJm R @p`/ NXO.rgHp f / NHXO`6p f / NXO0JhgNv`hJng / NXO`XJtgN`LJzg / NXO`"907A@"907AB"90N fPOJlR /3/ N PPOJl "',`` '`L N^NuNVH0$nBHnHy8Hy8Nx &@Jgd/ HxHnjN JgFHxHnHnjNL rn*Hn/.N POJg .ư f/./ N PO``/ NXO L N^NuNVH0*. &nJg *g ;fp`B Ю,g  g  g  g  fR`$Kg :gR` l$ + g + g + g + fS`S FB E R" ! // /N ^ g :gR`gR```b E B L N^NuNVH0&n E8`RRg4 A\Dg Z_DJgHH./bin/spool.bin 7442 0 0 34614 4007606776 6707 0`&SJm R @ ` / /NPO`L N^NuNVH0&nE0Jf p<$R0SJm R @p ` / Hx NvPOSR0L N^NuNV/ &nSJm R @p ` / Hx N8POp<#0R0R0&_N^NuNVH0&n(. $KЄYBHnHy2Hy0N *Jg/Hx HnN r fn0.Hg\HxHy2HnN JfBHxHnNNPO. Zn* ZSB/Hn/ Nr R%`|/N XO B" L N^NuNV6H0$nG6AJ./ / HnNPO/NPOJgJ0gp0fp0+*0Nz,HxNXO.NHx/N PO&@Jg/ JX//N < `NpL N^NuNVH0&n 90fg`A1 $@JfB/ NPO``Hy1/NPOJfB/ NPO`BBHn/N!.JgB//HxN'z`dp0g/Hy1HxN'B /./NT.N~PO/.N!XOp0g /N XO.JgB//HxN'XJfJNxpL N^NuNVH0&n$K KRg /g ^f$K` L N^NuNVFH0GrEz/./ NPOHnN.HnNPONbBHx/ HnN N-@vJgr&NVpgHxFB/N!* B0p#0r<# N^NuNVH0&n$n ` Jfp`rRR A\Dg Z_DJgHHм `HH-@ A\Dg Z_DJgHHм `HH".gHHHHL N^NuNV/ /.NXO&@Jg `Hy3\HxNjPOHxNXO&_N^NuNVN^NuNVH0E &n/. HnNNPOHnN (XOHnN .Hy4$NPO/ HnNPO/ Hy40NPO/ HnNPO/ Hy4BHxHn/ N .p7@ ` BHxHn/ N .p7@ `~JgBk p` 7nB L N^NuNVH0&n$n Hx/ N PO rfp7@ ` wfp7@ ``"Hn/.N POJg`7nB `Bk pL N^NuNV2@,4NVH0N $n G0A./ / NPO-@Jg ÊҀÊ``/ NtXO$@Jg GJg GJg GJg GJg G/90Hxw/+ N  #0/90Hxr/+&N #0N #0Hx 90gr`p"//90Hxp/+,N X#0HxHx/90Hxm/+2N 4#0HxB/90Hxb/+DN #0HxHx/90Hxs/+JN #0HxHx/90Hxt/+PN #0HxB/90Hxu/+VN #0HxB/90Hxz/+\N #fp0+D/p0+4//+0/+,p0+(/p0+6/p0+6/p0+$/p0+*//NPO// p0+&rf A2 `A2 /Hy2HxN4L N^NuNV.H0$n *.GBHn/N~POJVDHH,`/ /Hn.NPO/NPOJgj// N"POJgJgXp0+$fLp0+*0gJ0f6~Hn.NXOJg&p0gp0+$// Hy2HxNXJfvJf/Hy3HxN pL N^NuNVH0$n*. GBHn/NPOJVDHH,`/ /Hn.NPO/NPOJg// N@POJgJgp0+$fp0+*0gJ0fv~p0+0HnNHy1/N .JgTp0g/p0**// N Hn`Hy1/. NF ,Jg//N`PO/NXO/NXO%y00%y0,BB/N HnvHxF/ /N /N 2XONdHnHnN`PONj`BHn/.vHxN%rpL N^NuNV/ &nN Jg/NBXOJgX`*Hy1N.XOJfHy1HxN% POHxN$XON &_N^NuNVxH0$nG/ / NvPOHnxHx/ N .Jfpxgp`4Hx / N"PO// Hy0N^ Hy0Hx/ N V pL N^NuNVx/NPHnNXOHy0NXOHxHxHnxHy2N",.gBB/Hx 2Ax\Dg 2Zx_DJg2xHHм `2xHH".䰁f`\ EJPf E"h 21H&,<`JSJm$ R @-H gp$`p n`/ gp$`p /NJPO ,JfRp o2xf2SJm R @p ` / Hx NPORp nSJm R @p ` / Hx NPOSJm R @p ` / Hx NPOpL N^NuNVN^NuHop0//NP6N@FNuNVH0..&n Y/HxNf,`/ //N@ SJfpl$$k"'s'/ S//N `L N^NuNVH0&n,. $s І. nV l R/3 /3& H0$n&nB`0SJm R @p`/ NRXO,rf` JRR m L N^NuNVH0&n0+ Hfp`0+ Hgp`tJfp`j$k`20+Hr.gBB0+H/HxNp`< .ÊҀÊHn // 0+H/N 7@J@f&'|pL N^NuNVH0$n,.&J~XS J o8 FSJm F R @p`/N@XO.rgp g KR`BpWDg" WDJgp` L N^NuNVH0&nER0+ Hfp`0+ Hg./ 0+H/N PO7@J@g0+Hr.g`~` `Jf"HxNXO'@Jgk `N@QHUHHLNu /"/N@UHHNu"_" _N@UHH//N"/ / o "oN@UHHNu@$ @ B@D  @B!B@ H! @ @ /NNPO/N L N^NuNVN^NuNVH0&n $n .SJggrt `RR`pL N^NuNVH0$n &n` Jfp`RRgHHHHL N^NuNVH&n~` KRpf ` R o . LN^NuNVH0&n .ËҀË$KB .SJg&S/. Hx Nr0ҟA /Hx N ` L N^NuNVH0$n &nBBBB  g  g  g  fR` +fR` -fp-@RB A\Dg Z_DJgHHм `HH.p0nr9m0`panrfm Wv``Hx /N П, Ї(RR`Jfp`P s%-8s%5ld %2ld:%-3ld%3ld %6ld %6ld %7ld %5ld ->%-24s (%ld) deleted %-16s not found %-16s not changed %-16s changed %-16s not found /Insufficient memory @(#)spool.c 1.12 (1/22/87)shell-pdaemon1Q68010 XPU 151 Spool source 1.12 Copyright (c) 1986 Cromemco, Inc. 4\ User - Date - Time - Filename - @(#)header.c 1.12 (1/22/87)@(#)letter.asm 1.12 (1/22/87)a5b5c5d5e5f5g6h6&H0G$n'n'n 'J/ Hx NPO.Jg `P . SkF n>H0;N$$$$$$$$$*6666**$$ ` + ሀ$pL N^NuNVH0&n $n-J-KHnHx$NBPOL N^NuNVH0&nE/ Hx0NPO.Jg `j jjpL N^NuNVH0E&n/ Hx2NPO.Jg `j jpL N^NuNVH0G$n 'n/ Hx4NPO.Jg `$ pL N^NuNV/ G'n'n 'n / Hx5NLPO&_N^NuNVH&nHnHx:N*PO.Jg `&pLN^NuNVH0G$n 'n / HxB03p8630r/etc/passwd/dev/999 9$sh-csh-c9999999999999%3s-%02ld-%04ld %02ld:%02ld:%02ld//::JanFebMarAprMayJunJulAugSepOctNovDecTI$I$I$I$I$ p7@`N/ Hx&/+0+H/N 7@J@g0+Hr.g`Jg``S'R R @p`,k 0+HrgBB0+H/HxN pL N^NuNVH0$n &ngw7Rx7fy7zz70717273747586878.88B98V/8j:8~.8*8_8$88000000  {3c3NPO.$ L N^NuNVH0$nG'J'n'n/ HxHNPO.Jg ` n pL N^NuNVH0$n G'n'R'n 'n/ HxPNbPO.Jg `$pL N^NuH0/2/ AH@B@2/Ё/@L.Nu//lD//lDa:Jo lDJolD/_.Nu//lD//lDaJo lD/_.Nua.Nua /o.NuJof&/p0/?@0/?@H@?@ NuH$/r2/0/R@eL?A2/?A"/ /2/2/HABAdS@ԯ/@/BLNu/A2/`NV-nHnHxFNPON^NuH $oL /./bin/strcmp.bin 7442 77777 77777 2432 4007607021 7322 0HxN >pL N^NuNVH0$n &n/ / N^PO.Jf / NXO. L N^NuNVH0| n $p" g JR -fgR -f`J*WDHH* JRHH.JgtpA_Dg rZ\DJg м ` .&n`Jf`J\HHfJg`6J+fp'@`Jg n R'pJf` `~`< `pL N^NuNVH0EG/ N|XOHxp/Hy9~Hxp+/Hy9Hxp+//.N /NPO/N /NPO/N L N^NuNVH0$nG/ NLXOHxp+/Hy9Hxp+/Hy9Hxp// N /N`PO/NUsage: Spool [-advhlkqf] [-w {on|off}] [-r {on|off}] [-c #] [-p #] [-m #] [-b #] [-s #] [-t #] [-u #] [-z #] [-n name] [[device] pathname ...] Filename User Seq Dev Pri Pages Lines Copies Form -----%s wrprtNot a character device: /dev/prt 3330/st/sq/usr/spool/sequence_numberSequence number locked out Option '%lc' has invalid argument onoffOption '%lc' needs "on" or "off" argument rsq%-3s%-24PO&_N^NuNVH0$n G'n'n'n / HxNPO.Jg `$pL N^NuNVH0$n G'n'n'n / Hx NrPO.Jg `$pL N^NuNVH0&n E%n/ Hx N6PO.Jg `&pL N^NuNV-nHnHx NPON^NuNV-nHnHx NPON^NuNV/ G'n'n 'n / HxNPO&_N^NuNVH0$n G'n'J'n / HxNPO. n L N^NuNVH0$n G'n'J'n / HxNHPO. n L N^NuNVH0&n E%n/ HxNPO.Jg `pL N^NuNV <00000000xx003{x00xx000000 0`3cp00000p<l   0```` 0`000000' 2 PO.Jg `$pL N^NuNV-nHnHx N PON^NuNV/ G'n'n 'n / HxNPO&_N^NuNVH0$n G'n'J'n / HxNPO. n L N^NuNVH0$n G'n'J'n / HxNlPO. n L N^NuNVH0G$n'n'n 'J/ Hx!N,PO.Jg `P . SkF n>H0;N$$2 DNVH0N*.$n G/ / NPO,Jg ÊҀÊ``Jg&Hn/+NTPOJg#&B*``Jg,Hn/+N(POJg .#&B*``Jg&Hn/+NPOJg#"p#*```Jf BNzXO.`LpfDBBHn/N .JgB//HxN $`/.N:XO./.N XO`` `Hy.HxN POHxN xXOL N^NuNVH,.HnHx/N  .JgBB/HxN `: .g UgUfg /N0XO.`/NXO.`Hy\HxN XPO~ LN^NuNVH,.10 XPU 151 Tail source 1.1 Copyright (c) 1986 Cromemco, Inc. o ` .&&Ѓn&E .&o. ".&o ` .&&Ѓ l*`"Hn // HxN .ËҀËn&E`"Hn // HxN .ËҀË n/.NXOpL N^NuNVN^NuHop0//NP6N@FNuNVH0| n $p" g JR -fgR -f`J*WDHH* JRHH.JgtpA_Dg rZ\DJg м ` .&n`Jf`J\HHfJg`6J+fp'@`Jg n R'pJf` `~`< `pL N^NuNVH0$n &nBBBB  g  g  g  ` // N1PO`B/ HxHx N)`^/ HnNbPOHy HnN POpoRHnNHxHxBN rf&B/HxN#p Hyf/N pPOJfNbHx S"hNXO`8BHxHxN#8 HyfJgHx/HxN /.NXONJNSLN^NuNVNWD/9Hy/9vN A $pB` JRhRnB3h yN// NPOJfp` RmpL N^NuNV/ N`&yJpg@"+ l0/+ /+/Hy/9NEP/9/9zN[PO&k`&_N^NuNVN_BBBN` rgPB/BNL rfB/M/. / /9NL .rf /9zNHtXOJfHxHxHxN Jg /. / N*PO LN^NuNVH0NQEGpf //NPO .Sѓ R nJnJo,/ R/(NR&Jf R&S`6 R , R/"R/)NR Ш/ R/(NR&Jf R&Hx/ R/(NRN2POpf/BNPO.`HxHxNPO.`$pf/BNPO.`HxHxNtPO.L N^NuNVNPN-JfN-h`HxHxpD/ yr"hN rf/9zNFXONL.8 9(, kL nDH0;N (8p&`*p`Fp fr&`p&`pfB`p&`p& AC#r yr"PNpL N^NuNVHNT&nB`3x Rx RT mLN^NuNVN^NuNVH0NTGEBp##JfHyfNXO.rfB/HxN" N`^Jgpg rgtfHpf$"$HBHBBB҂A C$&`gHy/9zNOpPONt`|`p R"R S/(/NU/9NU#V#FJgX 9FVoJBHxHxNf /9VHxNUHy/9N9 /9/9zNNPOHxN& `BHxHxN Hyf/.NPOJfN[N^NuNV/N_6 .gSfLJf yr"hN`6pf"9j f~`~`Jf 9j f~`~ .N^NuNVN^NuNVH0N^&.Gpfr ` Cp n $hr#p# C `.p# Cr `p# Cr ` p&`p'@`p'@HxF/. /.N rfp#@`p//(NQf й.p f y"gR`p& LN^NuNV/ NO6GJg: S-Hpf S"( `p" nҨ#p fB`p f S/./( NP"ӹ&_N^NuNV/NN y"h .S.1 .N^NuNVvH0NNG$nB/ NIPO,rf/9zNEXONJ~~// /NI */NHXOgp` +Cxf2 +Dzg +Szf" +S{f +D|g +S|f +D}f`p`h +Dzf p#` +Szfp# +D|f +Syfp`2 +Lyfp`&`$ +S|f +Syfp` +Lyfp``pL N^NuNVNMHy/9zNHPONjNTPO.gHy:/NTPO/./NTPOHyD/NTPOJg&/.$/. /.HyF/N>//NT|POL N^NuNV/NY HxNNXOJf~`B .N^NuNVH0NXGE/ HyjNGPO z_Dg a\DJgHH `HH. f~`B  g/ HynNFPO` L N^NuNVH0NXf&n$n ` Jfp`RRgHHHHL N^NuNVH0NX(&n$n gR` KR"JRg`L N^NuNVH0NW$n&JgR` L N^NuNVNWN^NuNVN^NuNVHNVNW&n NHn/ /.N .JgB/HxN< N8N.Hx/HxN BHxHx/N(rfHxHxHxN /NBXO&_N^NuNVH0NI",.GE/9HxHyfN' &rfHx/HxN BHxHx/N(4rfHxHxHxN /NBvXO gSg Sf N$`B^ g Sg Sf g~`~`~/9/HyfN'R &rfHx/HxN Sf,B/9.Hx/N'rf/9zN?FXONDL N^NuNVH0NH &nE^Jg /. / NPOB` yn RxR mJgR .f2/9./9n/9NC` ,Jf/9zN>XONCBL N^NuNVA/0/9/9/9Hy/NH//N^PO/90NrXOHy/N^PO/9,NX.Hy/NH //N^`PO yN//N^PPO`,N8f yN//9Hy/NHN//N^"PO yN(g Hy/N^PO yNHh/N]POHy/N]POJg,/9/9 /9Hy/NG//N]POL N^NuNVHNb@..G g KRpr` KRp- g KRpw` KRp- g KRpe` KRp-BHn/9zN]2POLN^NuNV/ Nap oG`G/./ /9NG /9/9zN\PO&_N^NuNVNOHyfNXO#jL N^NuNVHNSRGN4,  HH@HyHkNKPOyy.<BHx/9NM (rf/9zNJXONOJ// /9NN *gpLN^NuNVHNR .g Sg Sf gBB`|~//HyfN1n #rf/9zNIXONNLN^NuNVHNRV&n/.HxNPO.B//9NM2 *rf/9zNI>XONNJg /. / NPO/. / /9NM ,rf/9zNHXOpBfNN8 LN^NuNVHNQ&n/.HxNPO,B//9NL *rf/9zNHXON'@ HxB/. /.N rfp#@`p'@`p'@`p'@HxK/. /.N rfp#@``p'@`Xp'@ `Pp'@$`Hp'@(`@p'@,`8p'@0HxP/. /.NL rfp#@`p#x`xR`.Jgp`B`FJVDg "ЁAJVDHH#@Jf"$҂A,0RpoJ@gJ@gJg R`p`Jfp`B.9<` A "n "!RRlp@n#p@lr `LJ0g4BHy~NUPO#zrft#z/9zNRXOp``p#z C#fpL N^NuNVH0N[&n JfNIN^NuNVH0NMdG$nB/ NHPO.rf/9zND`XONI,<BHx/NH& (rf/9zND2XONIv// /NH */NFXOgp`JHyHkNnPOJfp`2HyHkNVPOJfp`HyHkN>POJfp`pL N^NuNVN^NuNVNL#FN^NuNVNLtN^NuNVHNLdG .g Sg Sf@gB`:~|pf.BHyfNF PO&rf/9zNC>XONH/NEXO//HyfN* &rf/9zNC XONHPLN^NuNVHNK&nJg /. / NPO/. / /9NGf .rf /9zNBXO LN^NuNVHNK|( HNGt&n,. // /9NB .Jfp`Bpf/9zN>`XONCJg // N,POJg/HxNIH ѹ LN^NuNVH0NF,.GzEHx/N&PO#rfHy/NB$POp` 9S( . RgSg SfgS//9*NH.//9*NH*Rm"g ro R*`f&B/Hx/N%rf/N=LXOp`PB/Hx/N%vrf(/Hy/9N+x /9/NAHPONBNHx/N%PO&rfHy /NA"POp`B^JghHx/N$PO&rfHy@/N@POp`BHx yn 9/ NPO-@rl:Hx / NPO-@/.NXO-@rf/././ N `zp fHB/ N2VPO#4rf/9zN.(XOp`8Hx/94NPO./94N0XO`Hx/ NzPO./HxN8/HxN8 gp`pП,JRgtJfp TodpoNhHxNXO To@p$"9U"9U(#.# JoR 9FU`B/ N1bPO#4rf/9zN-4XOp`D  n,///.// /94NfHxHx yN/ yr"h N rfN2&Jg&/9/9 //./// /9fNۺ JfbBBBnVH0;N $:G`:G`2G`*Hy&/N`GZ`2 RfG|`$ VgSg SfG`G`G/ /N;(POpfN<&L N^NuNVH0N?.. $n .k n~H0;NҀ.BHx D/ S"hN HxHx yN/ S"hN Nrf//D/ S"hN N`BHxHxN Hx D//94N+ rfBHxHxN LN^NuNVHN0&n /.HxN2./.HxN2 ПS(/ //Hy4/9N B/9HxHxNHxB/.N+b ,Hx/./.N+L *pgfp` LN^NuNVN^NuNVH0N0.< yNG yNE o KRHHހ` yNG yN м$@ o KRHHހ`HnHyt yNHhN rf ` fp`pL N^NuNVH0NHn/N -@rf-F`/NrXO 9 l-@-y r-ABJgJfHy/9zN6lPONJfp-@`zB yr"hNXO yr"PNB yr"hNXONN .Rf$ 9 fHn S/N4POJfB`Hy/9zN5PO`VJg`BB*JgG`` Tg SfG`G`F RfGN`8 RfGv`* VgSg SfG`GE`G/ / /9N$| /9/9zN:HPOpfN;FL N^NuNVN^NuNVHN>Gbpfr `BHyfN9PO#rf&tfpBfB`/9zN5XON:`XJfHxBBN rf~`:BHx yN/ yr"hN gB`N rf~`B/9N7XO yr"PN LN^NuNVN^NuNVH0N=E4GNB BN S/HnN6POJg`GV`Gv` RfG` k^ GJ,/ NnXOR/N*XO.JfB/ HxHxN`RHxN*xXO&JfB/ HxHxNr`,/ /N+PO S S!n  S!n Sp!@ S!FL N^NuNVHN2,.GrB/ S"hNXOHy/9zN.PONٞJg/ S"hNXO S"PNJbg~`BHxBN@ .rfHxHx/N& `/ S"hNBBBN rfBHxHxN `(BHxBN rfBHxHxN HxYNXOJg"~/ S"hNXOHxHxHxNҘ `N.6pfLN^NuNVHN1,.Gr/HxN3 R-@/HxN3 gp`p". Jg,pg"BHxHx N NH0;N$$$$$$$$$*6666**$ + ` + ሀ`pL N^NuNVH0N$nG'n'n 'J/ Hx!N&POJgp`P . SkF n>H0;NHxNL N^NuNV/ N^&n .g Sg R @HH`p`" SSJm S R @p`/NXO&_N^NuNVHN..&n .gpgS S"HH`p"` //NPO"LN^NuNVH0NG (.ENB .R @g  g  g  g %f .R @ *f .R @r=A`Bn 0\Dg 9_DH=@B`&Hx /N$ HHП0, .R @ 0m 9o lf .R @r=A`Bn Am Zn cfT/ /NPO.rf `.JngSJm/ /NPOrf ``JnfR .X @"P`JfNXOBB+ pHH'@+ HH/NXOJgp` LN^NuNV/ N8&n + HHg&+ HHfJg opfp`RS S p. &_N^NuNVH0N$n &n+ HHJg+ Hn/ / BNJg/ NbXOB+ L N^NuNVH0Nx&n $nHn/ / HxNL N^NuNVHNH&n .. .g R @ HH`* SSJm S R @ ` //NPOLN^NuNVH0N$n.. m2po," ҇&A 5m p0" f r1 nRP` SR 9nL N^NuNVH0NG ..E> .R @g %(Sn/ /NPO.S`JopegrEf/ /NPO.SJop+f/ /NPO.S`Jop-fr=A/ /NPO.SJo@p0n:r9m4 nl4.HHx /N П0=@/ /NPO.S`Jng 0.HD=@0.H2.HЁ=@// /N Jnf .`JnfRJngLHn0.H/2.H/HnNJngA/ / W .X @"PA""`JHn0.H/2.H/HnNJng/.NjWNP-_ .X @"P"` HHg .`D`6/ /NPO.r g p gt f`pf` HHg .` ` .``L N^NuNVH0N ~&n/.N'h N^NuNVN%fHx ogHx /N$Լ0&` 爐м0&/ /NPO.SRn`// /N Jnf .`Jnf D&Jnf(R hf .X @"P2` .X @"P"`r xftBBnBnJop+f/ /NPO.S`Jop-fr=A/ /NPO.SJo4p0f./ /NPO.SJopxgrXf/ /NPO.S`RnpA_Dg rZ\DJg м ` -@Jop0nr9lpanvrfmnp0f n -WDHH-AJgR n 0f Rp0@`p @B`(Hx /.N" .R @HHҟ0-A n 0m n 9o n .WDHH-@Jg@RB`$Hx /N .R @HHҟ0( n 0m n 9o n lfR .R @ Am Zn H@m>@mgBY@gU@g8W@f\g0@ kR @nJH0;N|||@cf.g( .X @,-FA&B. df^ fS"Cr8,<334J]"DAg D,S C/Hx Np0П/Hx N,f.gS Cr-` uf,S C/.Hx N`p0ПA/Hx ND JEg@S J m *R @"KRHH`Hj KRHH/NPO`HxNXOL N^NuNVH0N # BG EFB` JX"KX RpnL N^NuNVN/.HyFNPON^NuNVH0N..Epor` X"¼Ё".Jg&R&k, Гf.f F,( +f R$ k ѓ k'h`Ⱦn6 rn Г&@&A `V R!k fBA `<$&kfJygByNL#b/N"XO&@Jg &A `pL N^NuNVH0N&nYJgH y$h o#` l o #$j` yL N^NuNVHN#h&nB//<N%,/</N%< /HxN%.,B.po&Jf""A0$m $0RR`z` Rpf p#f`Bf LN^NuNVN". HH0N^NuNVN"p0ЮN^NuNVN^NuNVHN"GJgZ yN(g`L/HxN$/HxN$ gp`pП.BHx/ yr"hN ,rf `SpLN^NuNVHN" yNG*<BJg>Hx/І/ yr"hN ,rfHy/9zN*PO``B`< yN0xg.NrfHx/HxNN `Np#r ` R m// /N `H gfJo0.H"ҀS 60fS`.HH"ҀR$.-B2.HoH`SJf" .SJo.HH// /N `.gHx-/ /N 0.HnHx0/ /N B`,po6hHH// /N `Hx0/ /N R0.SnHnHx./ /N 0.RnHroJgSHx0/ /N ` SJg.po6hHH// /N `Hx0/ /N R` .SJo.HH// /N ``` HH// /N ` HH// /N `HJg R @BL N^NuNV/ N&nHn / HyBN&_N^NuNVH0N&n $nHn/ / Jl+ p`S'G R @pLN^NuNVHND&n *.R+ HHfp`+ HHg@EHxHn+ HH/N .pf"¼ `+ p`Jf@+ HxNXO'@&Jf HyN XO'| R @ `L ,//++ HH/N, .g + p`&'| R @ LN^NuNVHN,&n+ HHfp`\+ HHgp`HJfp`> ,//++ HH/N .g + p`&'|pLN^NuNVHN&n+ gP/ N^XO.+ HHg/+nr9m$銔Լ0&` 鈐мa &/ /NPO.SpA_Dg rZ\DJg м ` -@Rn`r// /N Jnf .`dJnf D&JnfR .X @"P"` sfxJnfR .X @-PJo8pg2r g,t g&p g Jnf ".R A/ /NPO.S`Jnf .R @B// /ND `z fg ef\BnBnBnBnBnJop+f/ /NPO.S`Jop-fr=A/ /NPO.SJo:p0n4r9m.4.Hpo4.RnH(`Rn/ /NPO.S`JoNp.fH/ /NPO.SJo8p0n2r9m,4.Hpo4.RnH) !K'J` #'KL N^NuNVN^Nu o"o / oSnNu o"ofNu o /o "/ SnNuNNU0- m2R@I`$`BA4TBB&O`QBQB0- m2R@I"M`$`TAA/ Q/0-R@H/NPONN]NNuNV/. /.?./././.N N^NuNV/.?.?./.N 4N^NuNV/.?.?./.N N^Nu"/N@ dNpNuBNuH o $<v N@d( @ f$<v N@e LNuNpLNu/ /g:NBt&xN@# / N."t&xN@# /N"t&xN@#" LNupVVVTONuHt0nJngB.0.H =@SCJClXDSG Glv R@=n>` p0pRGino.gBFB n 0`bA/ / NJgp?=@`A/ / NJgp-=@`p+=@=n~` pRGino n BP n-WDL N^ _NoHL UUðcACBBDfJgvJffҀ`j`f<< gf<D FmQFf쨴fҀd$RE|m`ZkgP[SEngBEd RE Eg0/A$L.NuJffg"<`B`"<`oHL$UUŰcBCEHN"JGf(gJFf `0 Fgp 00 ;o?o>NuBNu.NuAO /H@aH@XaXaA0par.Nu?a 0a0Nu@ o^<0Nuaddress $000000 Nu/0/ o m.on( /W\Nu/ / mn /W NuAp N//NZN?/@on 0/WXNuApN//N*N?0/@ @g0Nu /gAp`ApN//NN?0/@ @g0Nu /f / fApp`ATpN@//NNLN( XmNuA\pNNN,Range error String range error Floating point NAN Floating point infinity Stack overflow "0//J@ L~..NuLH>aFN`LH>a4N aL|..Nu o"_$.H0YO/La NL Nu$<&HCĀ(f<Jg,<`&HBJ|f4<`<Jg<`SB<B2NuLH0HNaH _POL N m `B>BFCa@ar, AKNux ,<.̂(ȃ⊄(΀ȁ∀NuJf F m F BJgk [ZNu<`6A/ / B/<@$N"n1pH|0H/NN RGinoJDl^ Dl4A/ / pD?NHN V/<7/?|"`6i?|"`,?| "`$ki?|"`?|"`i?| "`?|"㊰dB c?|"`f?|"L/_ NwH / "/BCBD@ARSDoHRm @4o <B`0BB`*2AA.I/ / HHgA/ / N ^ " _Nu?@$@Y@@@È@jA.AcAׄAeB_ B7HvBmB0@BּC k&4CAy7?CAy7FnI1sM8O?PQ_SubسcW0$fZwH02]ԀW8ua&%odyER0xg$k%LnqJRgq24zuOsJf Jj4XO`Gfl<$HBNFHB b $<JjTB`BBXO`xBփՂ\ ǖ[j ցՀ JD]Nu////////aL/_ NuHL$*xa8SGGo <SFaF NLN|H ,L..Nu"/ _A/ / ?NHNo"GA/ / ?NHN @A ` H>JGfA/ / BBNgP/ / B/JGfn noz`:.A/ / B/<@?NHN .NtA / / B/<@$NmRFP/ / B/<@$N p@xA/ / B/<@@N "VAH>`A/ / N =@ Go"P/ / H/NNB/<@ÈN v D@m(0.H H@=@"C@@$"H"D@@H! @@ A  @H @@ @ @ @ R!$@H @$ @@@  @$"" @@DD @"   @ B$ @$"!BN@HTgBN@EB&Nushell-c$/ oN@@TNu&_& O4`$"X$IBARAJf0R@@$OSA`QQ C0"OB`/ BATAAQ$X^/?<a>$O^/?<a0"O^/?<a" O/Bg/ C?SW// / HzNNuBCN@F o/ C\!I"_B(B(||1|Bh 1o 1|UU|B(B(B(BBB( _\ON _"/R -Ҁ$n+ANuApNDN?JT^lz Creating %sCreate %s? Adding %sAdd %s? Extracting %sExtract %s? Listing %6o %6o %11lo %11lo %s%1o%1o%-1o%6o Error in makhdr: tsum=%d %6o%6o%11lo %o%o%lo%loError in readhdr: tsize=%ld Size = %s Insert next volume: Error in blocks %ld to %ld, file "%s" I/O error reading Tar Archive for file "%s", block at location %ld Insert next volume: Incorrect volume inserted Not enough memory for I/O buffer Duplicate functions specified Error reading F, B, or K arguments No function specified Too many filenames; maximum=64 Nonexistent ./bin/tee.bin 7442 77777 77777 3627 4007607152 6603 0um error Cannot open archive Cannot read archive Cannot position archive to block Cannot open directory %s Cannot save char or block device: %s Cannot save "%s"; pathname exceeds 100 characters Directory entry table exhausted: "%s" Link table exhausted: "%s" I/O error writing file "%s" to archive. %sPrior archive contents OK. %s Error positioning the tape Error from position, block=%d Error in position from getmode Error in position from getmode Error from position, block=%d $n G'n'J'n / HxNPO. n L N^NuNVH0G..$n Joplp"`p'GA f SA"0` "'A/ Hx@NPO,Jg `2 n-H SA"+fC ` + n pL N^NuNVH0$n G'n'R'n 'n/ HxPNPO.Jg `$pL N^NuNVN^NuBH />A/N0XLDXNuaaaaaaaaNV/.HyHxNl HxNXON^NuNV-nHnHxFNPON^NuH $oL /N@QHUHHLNu /"/N@UHHNu"_" _N@UHH//N"/ / / ^.Nu / ].Nu / W.Nu _ Jg ^N _ N / mnJgp..Nup..Nu / ]..Nu / fJW..Nu _ JfJg ]%sList %s? Updating %sUpdate %s? JanFebMarAprMayJunJulAugSepOctNovDectarusage: %s -[rxtc{fbkvwmlnoisd}] {archive,blocksize,kilosize} {files...} /dev/tp1 %ld link to [Extent #%d of %d] Total Size %ld %c%c%s%s%d%d %5d/%-5d%7ld %s %2d : 19%2d %7ld %s link to [Extent #%d of %d] Total Size %ld 0%ld%2d%s linked to %d files; %d found /Can't save directory "%s"; nesting level exceeds %d option specified Tar archive already exists. Volume is a Cromix Tar diskette. Volume contains a Cromix file system. Volume is not a Cromix Tar diskette. Volume is a Cromix Tar diskette. Continue? ('n' response will be followed by prompt for new disk) (y/n): Volume contains a Cromix file system. Continue? ('n' response will be followed by prompt for new disk) (y/n): U (update) not yet implementedCromix Err Bad Archive Specified Directory specified as archive Illegal character device s2 _NVH0N$n / HyNPO-@Jg ÊҀÊ``hJf``HnHxHxN HxNXO&@Jg"BHxaHyNhPOJgp` </Hn/N.JgB//HxN$`BHn </ І/BN.JfJHn/. І/HxN .܀ f HnHx/ /.N.Jg`B`pfBJgBB/HxN`0Jg,Hn// /.Nx.JgBB/HxN`/.NXO/ N\XO`BB~/HxN8 `HyHxN POpL N^NuNVN^NuHop0//NP*  o "oN@UHHNu  *aUsage: Tee [-a] pathname @(#)tee.c 1.5 (1/22/87)1Q68010 XPU 151 Tee source 1.5 Copyright (c) 1986 Cromemco, Inc.  "$&(*,Unexpected signal number %ld +/p/N .Jg `,p+/p+/p+/N4 .Jg `pLN^NuNVH0&nEJ g~HyHxN PO/ BNPOJgSg"Sg2SfPg> y y `8 y R`$ jR`jR``z`xHyHxN PO/ BNPOJgSg"Sg2SfNg> y y `4 y R`  Rj`Rj/ NzXOJfL N^NuNVH0&nEHyHxNlPO/ BNzPOJgSg$Sg2SfNg<y y y `2y RB+` RjB+`RjjHH/NPOJfpL N^NuNVH. . 9 g WDHH`h A\Dg Z_DJg HHм ` HH-@ A\Dg Z_DJg HHм ` HH".WDHH" LN^NuNVN^NuHop0//NP6N@FNuNVH0| n $p" g JR -fgR -f`J*WDHH* JRHH.JgtpA_Dg rZ\DJg м ` .&n`Jf`J\HHfJg`6J+fp'@`Jg n R'pJf` `~`< `pL N^NuNVH0$n &n` Jfp`RRgHHHHL N^NuNV/ &n-KN ܀/HxmN. *ALp0XހCp1Xd Rr1GVp l RE м<LN^NuNVN^Nu"/g@ o/4|gSH4H@04<A` Qd`QNu$/ gL o"o02 |f|g `&|g SrB`"Qd$`QdNu$/ g o"o`QNu"/g8 o4|gS4<A` Qd`QNuNVH0$n G'n'J'n / HxN(PO. n L N^NuNVH0&nE/ Hx0NPO.Jg `j jjpL N^NuNV./bin/time.bin 7442 77777 77777 7627 4007607201 6763 0:  %02ld%02ld%02ld@(#)time.c 1.1 (1/22/87)JanuaryFebruaryMarchAprilMayJuneJulyAugustSeptemberOctoberNovemberDecemberSundayMondayTuesdayWednesdayThursdayFridaySaturday1Q68010 XPU 151 Time source 1.1 Copyright (c) 1986 Cromemco, Inc.  *I ./bin/testinp.bin 7442 77777 77777 3217 4007607163 7511 0/ NXOJf|L N^NuNVH0E/ HxOHn/.N@,JgBB/HxNp` B6GB`jg 0\Dg 9_DJfR`gDB`Hx /NHH0П.R 0m 9o op` n ``Rpn L N^NuNV/ &nHn/ N.NlPOHxHn/ N| JVDHH&_N^NuNV/ G p+/p+/p/HyHxN&_N^NuNVN^NuHop0//NP6N@FNuNVH0| n $p" g JR -fgR -f`J*WDHH* JRHH.JgtpA_Dg rZ\DJg м ` .&nHnHxNPO&_N^NuNVH0$n G'n'n'n / Hx NzPO.Jg `$pL N^NuNV-nHnHx NHPON^NuNVH0$n G'n'J'n / HxNPO. n L N^NuH $oL /N@QHUHHLNu /"/N@UHHNu"_" _N@UHH//N"/ / o "oN@UHHNu@@ Vdefr-Usage: Testinp [-defr] file string [string ...] @(#)testinp.c 1.4 (1/22/87/ G'n'n 'n / Hx1NPO&_N^NuNVH0E&n/ Hx2NPO.Jg `j jpL N^NuNV/ G'n'n 'n / Hx3N4PO&_N^NuH0/2/ AH@B@2/Ё/@L.Nu//lD//lDa:Jo lDJolD/_.Nu//lD//lDaJo lD/_.Nua.Nua /o.NuJof&/p0/?@0/?@H@?@ NuH$/r2/0/R@eL?A2/?A"/ /2/2/HABAdS@ԯ/@/BLNu/A2/`H $oL /N@QHUHHLNu /"/N@UHHNu204 NVH0ND&n E/ / N4PO-@Jg ËҀË``hJg`bHxe/ NPO# NjHxs/ NPOJg$N>.JgBB/HxN rp`.N6Hx2/ NPOJgNZp`HyHxN (POpL N^NuNVH0E G / NXOHy N "XOp+Ad/0HyHxN J g,p+A0/0p+/HyHxN`*p+/p+A0/0HyHxNp9 /p9 /p9 /pмl/HyHxNL N^NuNVHGHx/ NNPO/ Nh.NXOp+/p./bin/touch.bin 7442 77777 77777 2631 4007607211 7136 02 PNVH0N&n E/ HyNPO-@Jg ËҀË``JgJf`Hy"/N8POJfHkBNPO.`PBB/ /Nv.JgB//HxNV`&Hk/NRPO.Jg/NXO/N|XOJg JWDHH. `Hy$HxNPOpL N^NuNVH0GE/ Hx/ /.NB.JgpgBB/HxN`LJg S 3 g S 3 fS` B3 n Jg . X @// NPOJgp``pL N^NuNVH0&n$n JgHH/HH/N:PO`*` Jfp` RRHH/`Jf`J\HHfJg`6J+fp'@`Jg n R'pJf` `~`< `pL N^NuNV/ &nHH g\` +&_N^NuNVH0&n $n .SJggrt `RR`pL N^NuNVH&np<,p+.rc  S`WHxm/N П"Ёr+ЁALr0x*/<Q/Nnp+Пr+t+HxDHNT\fnx %9s, %ld %s%s %ld, %ld %2ld:%02ld:%02ld DATE (dd/mm/yy): DATE (mm/dd/yy): TIME (hh:mm:ss)* 2 t<DNVH0N&n E/ HyNrPO,`Jf`BHx/ /3N.f/N.NXO.`@pf:HxcHyNPOJf&BHx/ /3N .f /NXO.JgB /3/HxNhRmfp`HyHxN0POpL N^NuNVH,.Hn/NPO.f"BB/NT p.//NPO.`*pf$Hx /NPOBB/N /NXO.JgBB/HxNLN^NuNVN^NuHop0//NP6N@FNuNVH0| n $p" g JR -fgR -f`J*Wgg . ` /Hy!/.NPO/NPO .L N^NuNVN^NuNVH0| n $p" g JR -fgR -f`J*WDHH* JRHH.JgtpA_Dg rZ\DJg м ` .&n`Jf`J\HHfJg`6J+fp'@`Jg n R'pJf` `~`< `pL N^NuNV/ &nHH g\` +&_N^NuNVH0$n &n` Jfp`RRgHHHHL N^NuNVH&n~` KRpf ` R o . LN^NuNVH0$n &nBBBB  g  g  g  fR` +fR` -fp-@./bin/unmount.bin 7442 0 0 13214 4007607227 7241 0 `$pL N^NuNV-nHnHx NPON^NuNV/ G'n'n 'n / HxNPO&_N^NuNVH0$nG'n'n 'n 'n/ HxNPO.Jg `$ pL N^NuNVH0$n G'n'J'n / HxNdPO. n L N^NuNVH0$n G'n'J'n / HxN$PO. n L N^NuNVH0$n G'n'J'n / HxNPO. n L N^NuNVH0G$n'n'n 'J/ Hx NPO.Jg `P . SkF n>H0;N$$$$$$$$$*6666**$$ ` + ሀ$pL N^NuNV`/ /+N:POJfp0+`&S fpL N^NuNVpH0EGpBHx/ Hy N .JgBHy /HxN$`B`/ /.NPOJf` HnHx/ /N .JgpfBJgBB/HxN`FHx/ NPO/B/N T HnHx/ /N .JgBB/HxN/N XO L N^NuNVpN^NuHop0//NP6N@FNuNVhH0BBBHn/.NpJfHxHnl/.N JfHxHnlHnlN rnhHn/.tNPOJgVHx/.lNPO,/NBXO$@Jg8Hx N2XO&@Jg //.l/ N 7n'J&. `/ N@ @D AD @  \x/etc/mtab/etc/mutab/etc/passwd/etc/groupUsage: unmount [-x] devname @(#)unmount.c 1.4 (1/22/87)$1Q68010 XPU 151 Unmount source 1.4 Copyright (c) 1986 Cromemco, Inc. r/etc/passwd/dev/DHH* JRHH.JgtpA_Dg rZ\DJg м ` .&n`Jf`J\HHfJg`6J+fp'@`Jg n R'pJf` `~`< `pL N^NuNV/ &nHH g\` +&_N^NuNVH0$n G'n'n'n / HxN PO.Jg `$pL N^NuNVH0$n G'n'n'n / Hx NPO.Jg `$pL N^NuNV-nHnHx NPON^NuNV-nHnHx NtPON^NuNV/ G'n'n 'n / HxNHPO&_N^NuNVH0&n E%n/ HxNPO.Jg `pL N^NuH $oRB A\Dg Z_DJgHHм `HH.p0nr9m0`panrfm Wv``Hx /N( П, Ї(RR`Jfp`P A\Dg Z_DJgHHм `HHrhf,R`Jgp` .g"D`"$ L N^NuNVH0&n$n JRgR` L N^NuNVH0..E!HxNPOpLN^NuNVdH0GE|`HndHx/N RpnHntBN*POHnpBNPOBHxBNL HnlHxBHxBN \/./ NPO/ / NPOHn|/ NDPO.JgB/ /HxNN`z/.p/.t/.|Nx .JgBHy /HxN`HHxxHy NPOJWDHH// N PO.JgB/ /HxN` / NrXO.HnlHx/.lHxBN BHxBNT L N^NuNVH0$n H0G$n 'n/ Hx4NPO.Jg `$ pL N^NuNV/ G'n'n 'n / Hx5NPO&_N^NuNVH0G$n 'n/ Hx6NPO.Jg `$ pL N^NuNVH0G..$n Joplp"`p'GA f SA!@"0` "'A/ Hx@NBPO,Jg `2 n-H SA!@"+fC ` + n pL N^NuNVH0$n G'n'R'n 'n/ HxPNPO.Jg `$pL N^NuH0/2/ AH@B@2/Ё/@L.Nu//lD//lDa:Jo lDJolD/_.Nu//lD//lDaJo lDXO`b/.NXO/NvXOL N^NuNVH0G$n / S// /.N,Jg `LJg@ S2HH.p WDf r WDfp WDfp WDJf`S` B2pL N^NuNVH0*. &nJg *g ;fp`B Ю,g  g  g  g  fR`$Kg :gR` l$ + g + g + g + fS`S FB E R" ! // /N g :gR`gR```b E B L N^NuNVH0&n g .&$K&G` L N^NuNVH0&n E!`RRg4 A\Dg Z_DJgHHм `HHHH!,!0!4!8sh-csh-cUnexpected signal number %ld L /N@QHUHHLNu /"/N@UHHNu"_" _N@UHH//N"/ / o "oN@UHHNu@  2cUsage: touch [-c] file file ... @(#)touch.c 1.3 (1/22/87)<1Q68010 XPU 151 Touch source 1.3 Copyright (c) 1986 Cromemco, Inc. !A/NXLDXNuaaaaaaaaNV/.Hy!`HxNl HxNXON^NuNV-nHnHxFNPON^NuH $oL /N@QHUHHLNu /"/N@UHHNu"_" _N@UHH//N"/ / o "oN@UHHNu @  @+ ./bin/usage.bin 7442 77777 77777 5350 4007607242 7125 020$NVH0N&n E/ Hy N"PO-@Jg ËҀË``BHxBN Jf*HnNXO.JgBB/HxN`NB`nB`f/ Hx/N4 ,JgB//HxNh~`8pf /N\XO`&Jf /NXO`/Hy (HxN ~XJfJgp`p`Hy NHxNPOpL N^NuNVlH0BHn/.N PO$@Jgl/ /.NPOB`N/.HnlNPO&@ +/g +^gHy / NPO&@ /2/ NPOHnlN(XORm/ NXOJgp`pL N^NuNVH0E&nHxvHy N\POJg/ Hy N$.JfHy!8Hx / /.Nh.Jfp !8f2*H¼gB*/ +/WDf +^WDJg `Hy/ NPO/NPOHy BHy N4 .Jg`L/9!p0*/Hy  y!N Jf$ y!p(rf a.Jg``"pfB/.NpXOBJgpgBHy /HxN~ L N^NuNVN^NuNVH0&n$n JRgR` L N^NuNVH0..Epor` X"¼Ё".JgD&R&k* n. Pn Г&@&` R!k fBA `<$&kf м,/N&XO&@Jfp`& `/ NXO`p`J fp`p0./NFXO=@/9 B/Nz \ HxcHy N POJg:p# Hx/NPOHx/NPOHnHxHn/Np`fHnHxHn/N@p0.rop# t `0HnHxHn/N 0.ְnfr`p"# pL N^NuNV|H0G$n J f(/ 9 A /0Hy HxN`h/9 B/.N b Hn|Hx/ /.N8 .|B3/ 9 A!/0"9 C/1Hy HxNnp fr`p" L N^NuNV|N^NuHop0//NP6N@FNuAp//ysical disk space: %l,d blocks %s @(#)usage.c 1.3 (1/22/87)V1Q68010 XPU 151 Usage source 1.3 Copyright (c) 1986 Cromemco, Inc. /I <(. &n$K* Є/Hx N ( ÊҀÊB SJgR0*Hg>Hx/ NdPO.rm`R S2gSB Ї& SJg SS C``B` E ! KRg`Rn E B L N^NuNVH&nJk gP/ NXO.0+ HgHx/+N8POBBk pH'@2+H/NXOJgp` `pLN^NuNVB/. HnHxN N^NuNVH0&n$n Hx/ N~PO rfp7@ ` wfp7@ ``"Hn/.NPOJg`7nB `Bk pL N^NuNVH0&n0+ Hfp`0+ Hgp`tJfp`j$k`20+Hr.gB20NV/ N&n / HyN PO-@Jg ËҀË``2JfHnNXOHnN8XO`` /N,XOXJf 9 `Hy HxNFPOp&_N^NuNV/ &n/ HyfHxN B B B AJ// NNPOJg p# `/9 /9 Hy$HxN/9 NXO&_N^NuNV/ &np+rd/. Hy N:POJgp`& +ѹ  +$ѹ p0+ VDHH&_N^NuNVH0<.$n&R g.Sfp`" /SdA `A /aPO.`6Hx NXO$&@Jg6BBB`BBHxHxN~  "HxN HnHx/ N .JgB/ /HxN`Jg/ Hy HxN ~`dBHxcHy N POJgp`p// / N.JgB/ /HxN` /N0XO.f / /NZPO./NXOJgp`pL N^NuNVH0G,.E м(* B / Hx/ /N.Jg pfB`BB/HxN ` Ep0 g Ep0 f p# `& m Dp0 f p# `B p fr `p"//NPO.f\J fTBB/N / Hx/ /N,.JgpfB`BB/HxNR`// NPO# JgpX/N6XO`L N^NuNVB/.HnBN6Jgp` .N^NuNVH0$nYJg y&h o#` l o #&k` y!J%K&y Гf k ѓ k'h`&k Гf k ѓ k'h`#` #%JL N^NuNVN^NuNV/ &n-KHnHxNPO&_N^NuNVH0$n G'n'n'n / Hx NVPO.Jg `$pL N^NuNV-nHnHx N$PON^NuNVH0$n G'n'J'n / HxNPO. n L N^NuNVH0G$n'n'n 'J/ Hx NPO.Jg  / @00Nu#2F$We6tHZl~3"VG,ud>ɍ@ۮRdv!0g&vD4UJÎXn|1 wf.TE<ˬBُPftBSap '26L^׈hzRC q`(7&:DV`rcr@Q%"40N\թjxsbPA5$*8FTbp,ӥ>@+R:Nd_mv|ҭ$6 H;*Z^Ol}l~ .<ѵ)B8 Pof~Lt]&н49(J Xnn\M| ׅ(:JD[iVx `/r>֍ 2ZKLyh^ h?.zՕ*8kFzHTY-b<pԝ"./bin/version.bin 7442 0 0 16465 4007607261 7232 0B0+H/HxN $p`< .ÊҀÊHn // 0+H/N7@J@f&'|pL N^NuNVH0&nER0+ Hfp`0+ Hg./ 0+H/NPO7@J@g0+Hr.g`~` `Jf"HxNdXO'@Jgk `p7@`N/ Hx&/+0+H/N7@J@g0+Hr.g`Jg``S'R R @p`,k 0+HrgBB0+H/HxN pL N^NuNVH0| n $p" g JR -fgR -f`J*WDHH* JRHH.JgtpA_Dg rZ\DJg м ` .&n`Jf`J\HL N^NuNV/ &n g/+a.a.NXO&_N^NuNVN^NuHop0//NP6N@FNuNVH0| n $p" g JR -fgR -f`J*WDHH* JRHH.JgtpA_Dg rZ\DJg м ` .&n`Jf`J\HHfJg`6J+fp'@`Jg n R'pJf` `~`< `pL N^NuNVH0G!E  &# !/./ NPOHy B/ NZ .JgB/ /HxNr~`8/ Sp0(// y!N Jf Sp(rfN. L N^NuNVH0E!G `RfBBHnHy`pL N^NuNVH&nB`Dp g p f(+f p fp`p"Ҁ# p`RR . SnpLN^NuNVp0. r2. ¼N^NuNVH0.. BB/N HnHy /Nx &@Jg8BnB BE . S Jg"SJm R @p`/ N NXOR`pfE J f# SJm R @p`/ N XOSJm R @p`/ NXOSJm R @p`/ NXOSJm R @p`/ NXOXSJm R @p`/ NXO*rf`,pfR`E Rp0.//NPO=@`P . SkF n>H0;N$$$$$$$$$*6666**$$ ` + ሀ$pL N^NuNVH0$n G'n'R'n 'n/ HxPNPO.Jg `$pL N^NuH $oL /N@QHUHHLNu /"/N@UHHNu"_" _N@UHH//N"/ / o "oN@UHHNu@ HD   H  @ @D AD  lUsage: Usage [file_list] Logical file space: %l,d bytes Ph0{jNXI\=,jxNVH0..&n Y/HxN ,`/ //N@ SJfpl$$k"'s'/ S//N `L N^NuNVH0&n,. $s І. nV l R/3 /3NPOJlR /3/ NPOJl "',`` '`L N^NuNVH0EBBHn/.N .JgB/./HxN `/ Hx/.N , pl"`p"/N XO&@Jg`JgRHn// /.N l.JgBB/HxN / NXO` n -H// N@PO n ` n BB`BBHxHxN X/.NXO L N^NuNVH0+ HfJg`6J+fp'@`Jg n R'pJf` `~`< `pL N^NuNV/ &nHH g\` +&_N^NuNVH0$n &n` Jfp`RRgHHHHL N^NuNVH&n~` KRpf ` R o . LN^NuNVH0EB/ NXO r Wg SgSfgG!`G!`G!`G! <// Hy!HxNL N^NuNVH0&n$n JRgR` L N^NuNVN^NuNVH0..E"por` X"¼Ё".JgD&R&k* n. Pn Г&@&` R!k fBA `<$&kf м20 4NVH0N$n G/ HyNrPO-@Jg ÊҀÊ``Jf`/NXO.rg/ Hx/N8 kB n:H0;N 22&222,B`p&`p&`p&` p&`p&po"AJg *g *` A"0 ,g/ A"pNXO*JgHnHx/ND &JgB//HxNp# `^/N\XOm/NXOl/HyrHxN p# `$/./N"PO(Jg//.//N`/HyLHxNV p# `/Hy.HxN8 p# 'J/ Hx NPO.Jg `P . SkF n>H0;N$$$$$$$$$*6666**$$ ` + ሀ$pL N^NuNVH0G$n'n'n 'J/ Hx!N@PO.Jg `P . SkF n>H0;N$$$$$$$$$*6666**$$ ` + ሀ$pL N^NuNV/ G'n'n 'n / Hx5NPO&_N^NuNVH0$n G'n'R'n 'n/ HxPNzPO.Jg `$pL N^NuNVH&nHnHxUNFPO.Jg `&pLN^NuH0/2/ AH@B@2/Ё/@L.Nu//lD//lDa:Jo lDHH* JRHH.JgtpA_Dg rZ\DJg м ` .&n`Jf`J\HHfJg`6J+fp'@`Jg n R'pJf` `~`< `pL N^NuNVH0&n $n .SJggrt `RR`pL N^NuNVH0&n$n JRgR` L N^NuNVB/.HnBNJgp` .N^NuNVH0$n G'n'n'n / Hx NPO.Jg `$pL N^NuNV-nHnHx NdPON^NuNV/ G'n'n 'n / HxN8PO&_N^NuNVH0G$n'n'n / HxNPO.Jg `$ pL @!H!P!X@(#)version.c 1.10 (11/13/86) 68RB CRC OK CRC ERRCRC SET1Q68010 XPU 151 Version source 1.10 Copyright (c) 1986 Cromemco, Inc. XPU XXU MMT %sCromix-Plus release %03lx /dev/@h/etc/sfdboot/etc/fdboot/etc/stdboot/etc/ufdboot/etc/hdboot!1Q68010 XPU 151 Wboot source 1.8 Copyright (c) 1986 Cromemco, Inc. r/etc/passwd/dev/sh-csh-cUTI ,/N&XO&@Jfp`& X/N6XO`L N^NuNVB/.HnBNJgp` .N^NuNVH0$nYJ"g y"&h "o#"` "l o #"&k` y"!J%K&y" Гf k ѓ k'h`&k Гf k ѓ k'h`#"` #"%JL N^NuNVN^Nu"/g@ o/4|gSH4H@04<A` Qd`QNu$/ gL o"o02 |f|g `&|g SrB`"Qd$`QdNu$/ g o"o`QNu"/g8 o4|gS4<A`  /NrXO 9 `HyHxNPOpL N^NuNVpH0Gx$n/ HnNPOBHx/ HnN.Jf:HntHx/N HnpHx/ND ptg~` ppf~)JgBHn/HxNp# & L N^NuNVH0,.GEHxB/N HnHx/ /N .JgBB/HxN2p# B`8HxHyHkNl Jfp0+$`/ Hx/Nn L N^NuNVA N^NuNVA N^NuNVA N^NuNVH&nB`o ` +.P +n LN^NuNVH0$n/. N*XO&@JgjBBHn/ N<.JgDJolD/_.Nu//lD//lDaJo lD/_.Nua.Nua /o.NuJof&/p0/?@0/?@H@?@ NuH$/r2/0/R@eL?A2/?A"/ /2/2/HABAdS@ԯ/@/BLNu/A2/`H $oL /N@QHUHHLNu /"/N@UHHNu"_" _N@UHH//N"/ / o "oN@UHHNu@ @D@  $  D N^NuNVH0$n G'n'J'n / HxNPO. n L N^NuNVH0$n G'n'J'n / HxNPO. n L N^NuNVH0G$n'n'n 'J/ Hx NDPO.Jg `P . SkF n>H0;N$$$$$$$$$*6666**$$ ` + ሀ$pL N^NuNVH0G$n'n'n 'J/ Hx!NPO.Jg `P . SkF n>H0;N$$$$$$$$$*6666**$$ ` + ሀ$pL N^NuNVH0$n G'n'R'n 'n/ HxPNPO.Jg `$pL N^NuH $oL /./bin/wboot.bin 7400 77777 77777 6525 4007607301 7146 0./bin/who.bin 7442 77777 77777 2557 4007607360 6625 0Qd`QNuNVH0$n G'n'n'n / Hx NPO.Jg `$pL N^NuNVH0&n E%n/ Hx N^PO.Jg `&pL N^NuNV-nHnHx N,PON^NuNV/ G'n'n 'n / HxNPO&_N^NuNVH0$n G'n'J'n / HxNPO. n L N^NuNVH0$n G'n'J'n / HxNPO. n L N^NuNVH0&n E%n/ HxNVPO.Jg `pL N^NuNVH0$n G'n'J'n / HxNPO. n L N^NuNVH0G$n'n'nB/ /HxN8`:Hn/. / /.N.JgBB/HxN/.N,XO`BBHxHxN fp# L N^NuNVH0$n &n`d +l +` .,Jn`D/B/.N Hn/ Hr/.Nv.JgBB/HxN^~` P +nJg# L N^NuNVN^NuHop0//NP6N@FNuNVH0&n E`RRg4 A\Dg Z_DJgHHм `HHHHgg . ` /Hy/.NBPO/N:PO .L N^NuNVN^NuNVH0| n $p" g JR -fgR -f`J*W@D AD "!vc%-25s Not a file or a directory: "%s" Usage: Version [-vc] [list of files or directories] Insufficient memory Not a file: "%s" %s %s %s%s No version number: "%s" /r!4!8!<!N@QHUHHLNu /"/N@UHHNu"_" _N@UHH//N"/ / o "oN@UHHNu@ @  !88"X0H>XCannot boot from device "%s" No default boot file for device "%s" File "%s" too large Usage: Wboot device [pathname] cromixx, 2 9NVH0N&n EzJfBHyNPO.`XJfB/+NPO.`DHnHxHyN: .JgBHy/HxN`/.HyNPO. L N^NuNVH0$nGBBHn/ N<.JgB/ /HxN`nHnHx0/ /.Np.Jf*f+gp0+* gJ f / HxN8PO`pfBJgBB/HxNF/.NXO L N^NuNV/ &n B+B+ p0+(/p0+&/p+%/p+$/p+#/p+ мl/p+"/p+!AT/0/ HkHy/.N0&_N^NuNVN^NuHop0/H0;NB<6":^,Dl 0 * h  \ x :^~2VjtN0Hxp0+/Hnt/N".Jl`2Jg`p+ /p0+ /HntN!4 .`Hxp0+/Hnt/N.Jl`Jg`HntN!:XO.`HntN!NXO.Jg`HxHntNzPO/p0+/Hnt/N,.Jl``lHxp0+/Hnt/NP.Jl``Jg`@HntN XO.`0Hxp0+/Hnt/N.Jl`$Jg`Hx./bin/z80.bin 17442 0 0 40672 4007607434 6206 0h .ll l l l` <//.hHn/N.Jl`Jg`NHnd l l l` </Hnp+ /N. .dѮlѮhJg``j7nn `\Hjp+ /NPO.Jg`@j`6p+/p+ /N-PO.`p0+ $Hnd l ` </Hnp+ /N.Jdg"/.dp0+/Hn/NvJl` 7nf ` HnlHxp0+/Hn/N2.Jl` Jg` p0+ $/ /.lHnp+ /N.7j ` THxp0+/Hnt/N8.Jl` HJg` (HxHnp0+/Hntp+ //N (.@l/HxN8`HnHx/N+ pgBHy@l~/HxN7`HnHx Hn/N).Jfb0.Hf`HnHy@vHy@lHnPN$PO/N$PO/N$zPOHxHxHnHnPN'@.p&gr f`pf~5JgBHnP/HxN7,/N'XOBHxBN/ Jgp` .L N^NuNVH0EGBHxBN/ BB/ /. N&.JgB/. /HxN6`HnHx/N* .찮o~`b,.`XHn l ` <// /N(`.Jg`0/.p0.// /.N.Jg` .nJnJoBB/HxN6222p0+ $`.p+ $`$Hxp0+ /Hn/N.Jl`Jg`Hnp+ //p+ /p+ /Nz.`Hxp0+/Hnt/Nr.Jl`Jg`bHxp0+ /Hn/NF.Jl`VJg`6HnHntNLPO.`"Hxp0+ /Hn/N.Jl`Jg`Hnp+ /N8PO.`Hxp0+/Hnt/N.Jl`Jg`p+ /HntN$PO.`p+ /p+ /N8PO.`~p0+ // /+N .Jg`^7j `Tp0+ X c~@`*p0+ X/p0+/Hn/N2.Jl`.Jg`p0+/p0+ /NP6N@FNuNVH0$n G'n'n'n / Hx N PO.Jg `$pL N^NuNV-nHnHx NPON^NuNVH0$n G'n'J'n / HxNPO. n L N^NuNVH0G$n'n'n 'J/ Hx NhPO.Jg `P . SkF n>H0;N$$$$$$$$$*6666**$$ ` + ሀ$pL N^NuH $oL /N@QHUHHLNu /"/N@UHHNu"_" _N@UHH//N"/ / o "oN@UHHNu p0+ /Hn/N.Jl`Jg`p+ /HnHntN .`Hxp0+/Hnt/N.Jl`Jg`p+ /HntN PO.`vHxp0+/Hnt/NZ.Jl`jJg`JHntN XO.`:p+ /p0+ /N PO.`Hxp0+/Hnt/N.Jl`Jg`p+ /p+ // HntN .Jg`j `Hxp0+/Hnt/N.Jl`Jg`p+ /p+ // HntN p.Jg`lj `b/ p+ /N PO.Jg`Hj `>p+ /N XO.`*p+ /p+ /N PO.`p+ /N XO2P(<NVH0N(&n EBBSXJg S -f SJ(ft S (A\Dg S (Z_DJg S(HHм ` S(HHgf$SXv`-kJgUP```````nJf`JgHxHnN(POHnN%f.N XOJg A@ ` -@/N!`XOJgSX/.NPXO.-@Jl`"HnB/N,( ,JgBB/HxN:`Hx . /Hn/N$zJg`(< .///./N`*f`؅ .//./ /./N*f`v HxJl` ` Hxp0+/Hnt/NJgB.tHxp0+ /Hn/NJgB.HnHntp+/p+ /N+.` p0+ /p0+ // /+Nz.Jg` b7j ` Xp0+ Hx/N)p0+/Hn/ND.Jl` @Jg` p0+ /Hnp0+ /NV .Jg` p0+ Hx/N)$p0+/Hn/N.Jl` ` Hxp0+/Hnt/N.Jl` Jg` Hnp+ /HntN .Jg` xp+ k @nH0;ND$$0000<$$$jjjj$$ D$7j `^ D$j `R D'P `JHxp0+ /Hn/N`LHnHx/N* /.HxHxN. HnHx/N) /.HxHxN. /N&&XOBHxBN.p Jgp` .L N^NuNVH0&n&.E|B`/< /3N">POT܀R m༮oBBHxHxN5F`n:.p0.". RЁ8B`l / //N Jg`TE/< /3N!PO-@/."/"/3/NbJg`\ .@R mB //N Jg`4/. Hx@/N Jg`p0./HxB/N Jg` `pL N^NuNVdH0&n ,.EpA(*p0+rQfp+`p0+Jk Zn/Hnp0+ /Nt.`/ p0+//+p0+ dp0+ ` </Hnp0+ /Nj.Jg` X/p0+/Hn/N0.Jl`Jg`l7j `bHnNXO.Jg`Nn nnn `2p+/p+/p+ /N .` HnN*XO.Jg`n nn`p+/p+/p+ /N, .`/ p+ /NDPO.Jg`7j`p0+/p+ /p+ /NN .`r/ p+ /NfPO.Jg`X7j`Np0+/p+ /p+ /Np .`(/ NXO.Jg`7j` +HH/NT/dev/tty/etc/who%-10s %-10s %3s-%02ld-%04ld %02ld:%02ld:%02ld %5ld %5ld @(#)who.c 1.2 (1/22/87)000JanFebMarAprMayJunJulAugSepOctNovDec1Q68010 XPU 151 Who source 1.2 Copyright (c) 1986 Cromemco, Inc. *.`Hnl/ N PO.Jg`j no `Hk p+ /N PO.`/+ + HH/p+ /N .`$ Hnl/ p+ /p+ /N&.Jg`f .lgSgSgUfg~"`j ` 7j `'R `6$ Hnl/ p+ //p+ /p+ /N&b.Jg` .lgSgSgUfg~"`j ` 7j `'R `Bp0+ $Blp0+-@h .ll|Hnd l l l` </Hnp+ /N .Jdg/.d/.hHn/NJl`f .dѮlѮhJf dl``~pfJloB7nn `Bp0+ $Blp0+-@ /.Hn/N#Jg`L/.Hx/N# Jg`25|5|5nHx@/N#PO-@Jl`5n HxB/N"PO-@Jl`5n HnB/ Hx/N+,,JgBB/HxN9d`0S@gS@g8S@gJS@f^gZJgp0*rdcp0*AR/ /NPO,`.BB|7/HxN9 `BB|8/HxN8`|Jf jFfR/N)@XOJgHxdHnN$POJf jFfp0*, `/N)XOp`Hy@ HxN8zPOpL N^NuNVPH0&nEBHxBN1* g2HxHxHn/ N(4.JgB/ /HxN88`BB/ Hy@lN(.JgBHy.Jl` `$Hxp0+ /Hn/N.Jl` ` Hnp+ /p+ /N .Jg` p+ k @nH0;ND$$0000<$$$jjjj$$ D$7j `^ D$j `R D'P `JHxp0+ /Hn/N.Jl` <`$Hxp0+ /Hn/N.Jl` ` Hxp0+/Hnt/N.Jl` Jg` p+ S@kd @ n^H0;N(((VVVVV2222p0+ $`.p+ $`$Hxp0+ /Hn/N|.Jl` xJg` XHnp+ //p+ /HntN.` 0p+ S@kd @ n^H0;N(((VVVVV2, XO.`/ NXO.Jg`7j`p0+ rcp0+ `p/p0+/Hn/N .Jl`Jg`Hnp0+ /p+ /Nt .`xp0+ rcp0+ `p/p0+/Hn/N \.Jl`XJg`8Hnp0+ /p+ /NF .`/ p0+/p+ /N .Jl` Jg`7j`p0+/p+ /NPO.`/ p0+/NPO.Jg`7j`p0+/NXO.`N.`p0+$HnhHnl/ p+ /N.Jg`V7j7nn nk `@B`:p0+ /Hx//N 0.Jl`0Jg`p+ /p+ /Jg`p`BB/HxNHxN~XOL N^NuNVH&n*. B.B`& Jf`g "$3l.Rnֺo* /3/Hy@HxNl "3؁Bn/Hy@HxNF LN^NuNVN^NuHop0//NP6N@FNuNVH&n~` KRpf ` R o . LN^NuNVH0&n$n JRgR` L N^Nu"/g@ o/4|gSH4H@04<A` Qd`QNu$/ gL o"o02 |f|g `&|g SrB`"Qd$`QdNu$/ g o"o`QNu"/g8 olg LfR ,fR KR rASDg tZTDJg м ` @g@gS@g@gU@gW@fp0.//.NPO&lp`*Tn g(p0.//.NPO&lp` r㨊Tn(E rdfJl  D* rdg tufXp-@x gJxf Sp,r-AxS/Hx Nrp0ПSx/Hx NX*f gSp-`> rxf,S м0pr9d' *Jf`S ".-A| fJ g p.t0f JRp/HnNPO .|S|Jo pL N^NuNVH0$n G'n'J'n / HxN PO. n L N^NuNVH0$n G'n'J'n / HxN HPO. n L N^NuNVH0&n E%n/ HxN PO.Jg `pL N^NuNVH0$n G'n'J'n / HxN PO. n L N^NuNVH0$n G'n'n'n/ HxN PO.Jf$ L N^NuNVH0G$n 'n'n'J/ HxN HPOL N^NuNVH0G$n'n'n 'J/ Hx N PO.Jg `P . SkF n>H0;N$$$$$$$$$*6666**$$ ` + ሀ$n ,.G6HnB/ Hx/.N .Jg`Jp0+cp0+` /p0.// /.N.Jg`p0+d SB2p`BB/HxNpL N^NuNVH0$n G6HnB/ Hx/.N .Jg`Fp0+cp"`Jp0+/p0.// /.N.Jg` np0+ p`BB/HxNpL N^NuNV/ Gp0.@Hxp0.// /.NN&_N^NuNV/ GHxp0.// /.NJgp`p+r&_N^NuNVH0$n G67n'JHnB/ Hx/.N.JgBB/HxNJgp'n 'n / Hx1NPO&_N^NuNVH0E&n/ Hx2NPO.Jg `j jpL N^NuNV/ G'n'n 'n / Hx3N4PO&_N^NuNVH0G$n 'n/ Hx4N PO.Jg `$ pL N^NuNV/ G'n'n 'n / Hx5NPO&_N^NuNVH0G$n 'n/ Hx6NPO.Jg `$ pL N^NuNV/ G'n'n 'n / Hx7N\PO&_N^NuNVH&nHnHx8N:PO.Jg `&pLN^NuNV-nHnHx9NPON^NuNVH&nHnHx:NPO.Jg `&pLN^NuNVH0$nG/ /N.Jg`7j`p0+ /Hx//N.Jl`Jg`/NXO.`Hxp0+/Hnt/N .Jl`Jg`|p0+ /Hx EHh/Nn.l`pJg`Pp+ /p+ // EHhHntNr.p5f8 ECt!I EC@x r+ /r+ // /Hy@N4.Jg`7j`Hxp0+/Hnt/N.Jl`Jg`p0+ /Hx EHh/N.l`Jg` EHhHntNPO.p5f$ ECt!I EC@| /Hy@NPO.`BN.`8Hk p0+/p0+ /N .`Hnl/ p0+ //+ N4|gS4<A` Qd`QNuNVH0$nG'J'n . '@ < '@/ BNLPOL N^NuNV/ &n-KHnHxN(PO&_N^NuNV/ &n-KHnHxNPO&_N^NuNV/ &n-KHnHxNPO&_N^NuNVH0$n G'n'J'n/ HxNPOL N^NuNVH0&nE%K%n / HxN~POL N^NuNV/ &n-KHnHxNXPO&_N^NuNV/ G'n  .'@ <'@/ HxNPO&_N^NuNVH0$n G'n'n'n / HxNPO.Jg `$pL N^NuNVH0$n r./HnN~PO` o JRp/HnNbPO` .|S|Jor./HnNBPO``p @r2.//.NPO&lp`/./$n/ /.NpJgp`TnB-J`R .R @f g o(. .-@|"¼f .|S|Jor./HnNPO` SJg JRp/HnNxPO` .|S|Jor./HnNXPO``` /HnN>PO` /HnN(PO`0.Hm HnNJXOp0.L N^NuNV/ &n0+HrPn/ NXO k0+RkH&_N^NuNV/ &nJkg`&Hn0+H//+0H/N ^7@Bk&_N^$pL N^NuNVH0G$n'n'n 'J/ Hx!N PO.Jg `P . SkF n>H0;N$$$$$$$$$*6666**$$ ` + ሀ$pL N^NuNVH0$nG'n'J'n 'n 'n/ Hx"N POL N^NuNVH0$nG'n'J'n 'n 'n/ Hx#N POL N^NuNVH0&n $n-J-KHnHx$N zPOL N^NuNVH0&n E%n%K/ Hx%N JPOL N^NuNVH0&nE%K%n / Hx&N POL N^NuNV/ G'n'n / Hx'N PO&_N^NuNVH0G$n'n'n / Hx(N PO`pL N^NuNVH0$n G67n'JHnB/ Hx/.N.JgBB/HxNJgp`pL N^NuNVH0&nEHx0/ NrPO/ HxBN B`2/ Hx R/N 7 / /"R/N RpnL N^NuNVH0GE..:.pnrlp"`pJEWDf EWDJg `Aj &/ //N& ,Jg `2/ HxBN n"R Sr21 R S1 pL N^NuNVH0E/ HxBN F RGUkp0+/p0+/ R/(Nx Jg`X R .S7p  R .Sr1 HnB/ Hx R/(N.'n'n 'J/ Hx>NPOL N^NuNVH0$nG'n'n 'J/ Hx?NpPOL N^NuNVH0G..$n Joplp"`p'GA f SAA`"0` "'A/ Hx@NPO,Jg `2 n-H SAA`"+fC ` + n pL N^NuNV/ G'n'n / HxANPO&_N^NuNVH0G$n 'n / HxBNPO.$ L N^NuNV-nHnHxCNXPON^NuNVHnHxDNBPON^NuNVH0$n G'n'R / HxENPO.Jg `$ n  n pL N^NuNVH0$nG'J'n'n/ HxHNPO.Jg`7j7nn `/ N>XO.Jg`7j`p0+ f"p0+ /p0+//+/N R.`0p0+ rf"p0+ /p0+//+/N .`~"Jl`|`bp0+ //+ / /+N.Jg`@7j `8p0+ // p0+ /N .Jg`'R`/+N XO.`~Jg Gp@ `B+ p`pL N^NuNVlH0&n=nBnBnJmA-H KRg r%fB -fR 0f Rp0@`p @B`"Hx /.N KRHHП0-@ 0m 9o .fA/N'LXLDXNuaaaaaaaaNV-nHnHxFNPON^NuH $oL /N@QHUHHLNu /"/N@UHHNu"_" _N@System shutdown in 5 seconds @/bin/z80.bin/bin/sim.binUsage: Z80 [-s] [-d device-pathname] program-pathname [program-arguments] /dev/z80/z80z80.comsim.binJSYS #%02lxH %10l,d calls Total %10l,d calls @(#)z80.c 1.5 (12/3/86)1Q68010 XPU 151 Z80 simulator source 1.5 Copyright (c) 1986 Cromemco, Inc. ;^;`;b;d;f;h;j;lUnexpected signal number %ld ./cmd/check.cmd 7400 77777 77777 175 3400217443 7032 0./cmd 7463 77777 77777 0 4016377322 5157 1%This command file rebuilds the super block on a Cromix disk %call by: fixsb devname if '#1' = '' go howto makfs -r #1 icheck -s #1 boot exit %howto echo Call by: fixsb devname exit 1 UHH//N"/ / o "oN@UHHNu   !./cmd/bak.cmd 7463 77777 77777 77 3375011634 6511 0./bin/ed.bin 7442 77777 77777 24150 3444700167 11371 1./bin/screen.bin0% Check file structures % if '#1' = '-s' goto salvage dcheck #1 icheck #1 exit %salvage dcheck -s #2 icheck -s #2 boot - ./cmd/helpsys.cmd 7463 77777 77777 34 3566763005 7444 0% Ecc management % if "#1" = "" goto report ecc on ecc -t #1 >> /etc/msu_errs & exit %report ty /etc/msu_errs % This procedure is used to install CDOS programs on a Cromix disk if '#1' = '' goto argerror if #1 = fda goto install if #1 = fdb goto install if #1 = fdc goto install if #1 = fdd goto install if #1 = sfda goto install if #1 = sfdb goto install if #1 = sfdc goto install if #1 = sfdd goto install %argerror echo -e Wrong number of arguments echo -e 'Syntax: install fdx where fdx = fda, fdb, ..., sfda, sfdb, ...' exit %install del install2.cmd >* /dev/null cdoscopy #1 install.crx if -r install./cmd/newuser.msg 6421 77777 77777 22536 4006004254 7534 0% Simulate old l program ls -m #* tional devices, proceed as follows: First, make a backup copy of the Cromix-Plus disk. Make /gen the current directory, and copy the file sysdef to another file in the same directory. (Give the new file a suitable filename.) Edit the copy to define the drivers to be included in your Cromix-Plus Operating System. The sysdef file has a lot of comments in it, so it should be obvious how to edit the file. If you do not understand a particular part of the file, don't change it. Refer to the on-line manual (helhelp -d /usr/help/syslib #* ./cmd/newuser.cmd 7463 77777 77777 24 3457306677 7453 0.crx goto continue1 %noinstall echo -e install.crx file not present on CDOS disk exit %continue1 ren install.crx install2.cmd if -e /usr/pkg goto continue2 %createpkg makd /usr/pkg chowner bin /usr/pkg %continue2 install2 #1 del install2.cmd echo CDOS software from disk #1 now installed on this Cromix disk  XPU Cromix-Plus Release 150 Jan 23, 1987 To run Cromix-Plus, you need the following minimal hardware: - DPU or XPU with either 68000 or 68010 processor - 512K of memory - 16FDC or 64FDC controller - One floppy drive - One terminal hooked to FDC controller Additional supported hardware includes - TUART terminals - Octarts and/or IOP/quadarts - Octart or IOP terminals - Parallel printers on PRI or TUART - 3355 printers - Serial printers on FDC and TUARTS, X-ON/X-OFF protocol, ETX/ACK p./cmd/logerr.cmd 7463 77777 77777 156 3375012447 7267 0p sysdef) for detailed information. Generate a new operating system: crogen output_file [sysdef_file] Typically, "output_file" should be cromix (in the /gen directory). If "sysdef_file" is not specified, the file gen/sysdef will be used. After verifying that the new operating system is bootable, move it to the root directory (/) to overwrite the distributed cromix.sys. If necessary, edit the file /etc/iostartup.cmd to ensure downloading of Octarts, IOPs, or BIARTs (set up to download STDC). If necessa./cmd/install.cmd 7400 77777 77777 1475 3207730522 7452 0ty /cmd/newuser.msg ./cmd/l.cmd 7463 77777 77777 42 3375012400 6167 0rotocol, CLQ printers - Serial printers on Octart or IOP, X-ON/X-OFF protocol, ETX/ACK protocol - Floating point processor - Nine track magnetic tape - CNET hardware - Large and small floppy drives - Uniform style floppies - RAM disks - STDC hard disks - Floppy tape - WDI-II hard disks - XMM memory management unit - Z80 processor on XPU/DPU and in BIART, OCTART, and IOPX boards Cromix-Plus is bootable "as is". It is a minimally configured Cromix Operating System. If you want to support addi. ry, make a link from an existing terminal to /dev/console (set up for tty1). Note that the raw console will stay hooked to the FDC terminal even if you move the /dev/console to some other terminal. The /dev/console terminal is the terminal to be used as the standard input/output during the startup.cmd execution (date/time) and, occasionally, by other programs. However, you can log in normally on the tty1 terminal. Edit the /etc/ttys file to enable the necessary terminals. Presently only tty1 is enabled. ll, or - Some user program executes _update system call, or - Flush utility executes _update system call, or - Some user logs out, or - A device is unmounted (only that device), or - A device is closed by a utility (e.g. dcheck), or - During shutdown If the system is reset, intentionaly or unintentionaly, without the system buffers being flushed, the file structure may not be up to date or is even incorrect. 3. The management of system buffers was greatly reorganized. If the user has enough memoly. Version 02.46 of paslib.obj has this bug eliminated. If you are using PERSCI floppy drives, you should reference them as minor device numbers, instead of the usual 0 .. 3: fda 16 fdb 17 fdc 18 fdd 19 When asked for the root device, respond with 1,16 (instead of the usual 1,0). After booting is complete, use the device names dfda, dfdb, dfdc, dfdd instead of the usual fda, fdb, fdc, and fdd. Later, you can delete the nonexisting devices and rename existing devices. A uniform-styl PRI and TUART uslpt Serial printer driver for FDC and TUART otty Octart terminal driver oslpt Octart serial printer driver The old drivers, tty, lpt, slpt, qtty, and qslpt, are still provided. The new drivers are compatible with old ones except that Octart minor device numbers are contiguous: 0 .. 7 Octart 1 8 .. 15 Octart 2 16 .. 23 Octart 3 and so on. CLQ printers are supported by slpt, uslpt, and oslpt drivers. To use the slpt or uslpt driver, the CLQ sie options according to the proposed standard. Notable highlights are: - Options are one character - Unknown options mean errors - Options without an argument can be grouped together - If there is no input file given stdin is taken instead (if applicable) - Isolated dash means explicit stdin (if applicable) - Options must be written before other arguments Important notes. 1. Cromix-Plus cannot use the STDC unless it contains 01.20 firmware. If your STDC does not have this version of firmwareou can insert a new sheet of paper and issue the mode prt resume command to resume printing. As some terminals do not want to send the XON character if the terminal did not send the XOFF character beforehand, character drivers have been modified so that any character will restart output after the terminal output was stopped bue to mode PAUSE. Now, you can boot the operating system by resetting the computer. As an alternative, you can execute the following commands from your Cromix 20 system: mount fd? /drive /drive/bin/boot68 /drive/cromix The Cromix-Plus System should ask for the root device. When you answer all prompts, the booting will proceed through the login message. You can reboot the Cromix-Plus System normally. The file cromix.sys is the Cromix system file in a form that the Boot program understands. There is no way to boot earlierry available the number of system buffers should be increased (with 600 buffers the system performance is just great). This will result in greater speed (and bigger damage if the buffers are not flushed at reset or power failure). 4. Do not pull a floppy out of the device without unmounting it. If you happened to do it nevertheless, put the same floppy back and with some luck no harm will be done. 5. Shell retype capability is always enabled. It has been greatly reorganized. Each interactive Shelle floppy disk is a floppy with all tracks in the same format and all sectors the same size. Sector size might be 128, 256, or 512 bytes. Minor device number describes the physical characteristics of the device. Compute the minor device number as unit + small + dtrack + dual + sside + sdens where unit = 0, 1, 2, or 3 for A, B, C, D small = 4 if 5", zero if 8" dtrack = 8 if double tracked (not supported), zero otherwise dual = 16 if drives in pairs (PERSCI), zero if not sside = 32 if single gnal cable must be built as follows: TUART or PRI CLQ 2 <-----------> 4 3 <-----------> 3 7 <-----------> 7 See the comments in the /gen/sysdef file for the minor device numbers to be used with CLQ printers run from slpt and uslpt drivers. The oslpt (but not qslpt) driver can also support CLQ printers. To use a CLQ printer from oslpt driver the signal cable must be constructed as follows: OCTART CLQ 3 <-----------> 3 4 <-----------> 4 you should boot in two steps: Step 1. Make floppy the root device to boot Cromix-Plus on floppy. The iostartup.cmd will download the correct version of STDC firmware. Step 2. Reboot Cromix-Plus to hard disk. 2. Cromix-Plus has a number of important improvements. In particular, it does not write out system buffers to the disk as often as before, thereby resulting in greater speed. Specifically, the system buffers are written to the disk only when - Sync Shell command executes _update system ca./cmd/query.cmd 7463 77777 77777 1401 3462410121 7140 0 Cromix operating systems from a Cromix-Plus System. Cromix-Plus version 31.38 contains full memory protection using the XMM board (if one is present in the system). As long as XMM is enabled (see Mode amem) no user program can crash the system. Any intended violation will cause a Bus error to be generated and the user program will be aborted. A note of warning. Version 02.45 of paslib.obj (and earlier) has an innocent bug which causes all programs linked with this (and earlier) library to crash immediate now keeps a 4K buffer to store the commands that were executed. The CNTRL-R key retypes the last command. If an integer is typed before pressing CNTRL-R the command with that number will overwrite the command number. The History command will write out all stored commands. The Shell prompt is now the Login name followed by the command number in brackets. Release 144 brought new character drivers. These are utty FDC and TUART terminal driver ulpt Parallel printer driver forsided, zero if double sided sdens = 64 if single density, zero if double density The /dev directory contains no predefined device names for uniform-style floppies. Use initflop to initialize uniform-style floppies. Most new utilities are true 68000 programs. Their version number is always 30.xx. They do not need to execute under Cromix 20 or Cromix 11 series. New utilities are, as a rule, used in the same way as old ones. There are, however, some exceptions (refer to the Help utility). New utilities us 7 <-----------> 7 With such a signal cable a CLQ printer can be used as an XON/XOFF printer provided the following modes are selected for the CLQ device: hand to let the octart listen to the handshaking signals ff to let the driver expand FF character crignore to allow for unusual handling of CR by CLQ New printer drivers (ulpt, uslpt, oslpt) support mode PAUSE to handle single sheet paper. With mode PAUSE set, the printer will stop after each page (LENGTH lines). Y.  d /usr/query if '#1' = '-s' goto s_option if '#1' = '' goto no_arg %query_match match #1 query_data shift; if '#1' != '' goto query_match exit %s_option shift if '#1' = '' goto no_arg_s %system_match match #1 sys_data; echo match #1 jsys_data; echo match #1 mode_data; echo match #1 bmode_data; echo match #1 tmode_data; echo match #1 query_data shift; if '#1' != '' goto system_match exit %no_arg echo 'Syntax: query [-s] [string]' echo 'Contents of query data file:'; echo ty query_data eermcaps.old >* /dev/null move -f /drive/etc/ttys /drive/etc/ttys.old >* /dev/null move -f /drive/etc/welcome /drive/etc/welcome.old >* /dev/null move -f /drive/etc/ce_env /drive/etc/ce_env.old >* /dev/null move -f /drive/gen/sysdef /drive/gen/sysdef.old >* /dev/null move -f /drive/usr/unix/.startup.cmd /drive/usr/unix/.startup.cmd.old >* /dev/null d / cptree -vf / /drive move -f /drive/etc/startup.msg.new /drive/etc/startup.msg boot %howto echo "Usage: Update1 new_root_device" exit 1 % Shutdown system % msg -a */dev/null echo -n 'Time until system shutdown: 5 '; sleep 1 echo -n '4 '; sleep 1 echo -n '3 '; sleep 1 echo -n '2 '; sleep 1 echo -n '1 '; sleep 1 echo -n '0 '; sleep 1 echo; kill -2 1 ./cmd/vdt.cmd 7463 77777 77777 1116 3375017616 6612 0./cmd/update1.cmd 7463 77777 77777 1754 3727412077 7371 0./cmd/q.cmd 7463 77777 77777 1401 3462410121 11044 1./cmd/query.cmd0xit %no_arg_s echo 'Syntax: query [-s] [string]' echo 'Contents of system call and query data files:'; echo ty sys_data; echo; echo ty jsys_data; echo; echo ty mode_data; echo; echo ty bmode_data; echo; echo ty tmode_data; echo; echo ty query_data ./cmd/update2.cmd 7463 77777 77777 431 3740303525 7331 0./cmd/togcurs.cmd 7463 77777 77777 46 3375017510 7435 0% Cursor commands % if '#1' = 'clear' goto clr_screen if '#1' = 'curson' goto curs_on if '#1' = 'cursoff' goto curs_off if '#1' = 'wrapon' goto wrap_on if '#1' = 'wrapoff' goto wrap_off if '#1' = 'clock' goto hard_clock if '#1' = 'msg' goto disp_msg %syntax echo -e 'Usage: vdt {clear curson cursoff wrapon wrapoff clock msg [message]}' exit 1 %clr_screen echo -n 'E' exit %curs_off echo -n 'q' exit %curs_on echo -n 'r' exit %wrap_on echo -n '.n1' exit %wrap_off echo -n '.n0' exit %hard_% Build new root device % if x#1 = x goto howto mode -pause mount #1 /drive move -f /drive/etc/group /drive/etc/group.old >* /dev/null move -f /drive/etc/iostartup.cmd /drive/etc/iostartup.cmd.old >* /dev/null move -f /drive/etc/motd /drive/etc/motd.old >* /dev/null move -f /drive/etc/passwd /drive/etc/passwd.old >* /dev/null move -f /drive/etc/startup.cmd /drive/etc/startup.cmd.old >* /dev/null move -f /drive/etc/startup.msg /drive/etc/startup.msg.old >* /dev/null move -f /drive/etc/termcaps /drive/etc/t./cromix.sys 6400 77777 77777 347474 4016376267 6703 0./cmd/shutdown.cmd 7400 77777 77777 424 3670706432 7637 0% Update current root from Ftar Cromix % if x#1 = x goto howto d / mode -pause ftar -vx /dev/#1 mode pause echo "Run Update2 command on the next Ftar floppy" echo "If this was the last floppy, please execute the Boot command" exit %howto echo "Usage: Update2 floppy_name" exit 1 % Toggle cursor ON/OFF % echo -n 'Z' clock echo -n '.w--' exit %disp_msg shift echo -n ';' #* '1' exit /   ,  FFFFFFz     " & * . 2 6 : > B  $(,048<@DHLPTX\`dhlptx| //NPOSJl/ N~XOLN^NuNVH0,. *.//NPOJfp`Hx/NlPO$@ fp`l&jp0+rPf.//NPO.HxBHk G/(N /NXOBk0+Rk'HkNXOj/ NXO L N^NuNVH.. /.Nv.XO&@ gd e ` p*#DpLN^NuNVN^NuNVH0Hx 9/NPO$@Hx 9/NPO#"9ҹ#&@`"Hy/ NnPO'J <ÊҀÊ m 93|r 3~#L N^NuNV/ /. p0. /NPO&@0+Hfk/ NXXO`Jkgp0+aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa~azavaranajafaba^aZaVaRaNaJaFaBa>a:a6a2a.a*a&a"aaaaaa aaH //L(| OO//NgX._L fatNnaNsH(|@|HAXO/NXOLN^NuNVH&nkkHxNlXO.0+Hg A ` 9// NlPOk0+Hgk/ N>XO/N6XOLN^NuNVH&y`Z0+HgHHxNXO.0+Hg /NXO`$/ Nl,XOk/NXOk/ NtXO mLN^NuNVH0E&y`pa`Jf<:HM =|`Jf:HM =| =nB-nDpn:rn:IA=@-n< BnBn=n@L@`aaaaaaaaaaaaaaaaa~azavaranajafaba^aZaVaRaNaJaFaBa>a:a6a2a.a*a&a"aaaaaa aaJg>X g(|HWN(Xa&a@HWN(.NXaTa/ /?@ Y/o >`@/,yH?j-_Nh-H=o-o(|Nw@,y/n?n nN`/.L?j,_..f.9D/NI .NH.N.NPXO&@Jg/. / k NPO`pLN^NuNVH0&np0+ /NXO$@JgBk/ jNXO`p 7@k/ NXOpL N^NuNVH0,... Hx/NPOJg`Hx/NPO$@Jf`&jHxHyHkND Jg/ NXOp)#D`X XOHx /NPO FhSj"j` gB&n0*kf&p+rlNsNsHx/9NuNsNu(|Nu. <A"HA`BQQAhCa:a6a2a.a*a&a"aaaaaa aaa0+ n fbHxNlXO.0+Hg/NXO`@/ NkXOk/NXO0+Hgk/ NXO`/ N4.NXO m&y`z0+ n flHxNXO.0+Hgk/ NXO`/ Nk(XOk/NXO0+Hgk/ NdXO`/ N.N&XO` m|L N^NuNVH0,. *.&n/ / ENPOJ\DHH.$S g/ / ENPOJ\DHHg&J`$S g4/ / ENPOJ\DHHf/ / ENPOJ\DHHf&J` F &L N^NuNVH0$n&R g J"K L N^NuNVH<. f 9D</. /NPO&@JgDHxNwH瀀 o 0

Ns@|HNh/ y!O&1yF#.yLFNu o@|H##.h&3F _N`LFNu /HA"<h` L +.f6 +/g +^gJ+f yp0(, yp0(*T`: yp0(, yp0(* .f +/g +^gJ+fR//NAPO$@ g& /g ^f KR ^fHn/ NkPO$@`HxNa.XO. g8// NPO&@Jf / NBLXO`Jf/ f p0+ g 0+ j g p#D``p0*/N?LXO&@Jf`/ N>,XOR+k/ N>RXOHx /NVPOHx/. G/N Gh G1k  FhRj"j/N.N>.N=XO `*/ N=XO/ N=XO/NXO/ N=XO/ N=jXOpL N^NuNVH0$n &nHx/ NPO~`l Am Zo* am zo 0m 9o .g _g $f. A\Dg Z_DJgHHм `HH`` SRRJf /g6Jg2 *WDf [WDf ?WDJgp'`p#Dr ` /fR` L N^NuNVH0*. Ep(rg p#D`|B`/Hx.nXOHx/ NNPOJg`/ / NPOkjB/ N.t.N.XO/ N.f.N-XO L N^NuNVH0/.NXO$@Jfp`pp*rfp/#Dt `Vp0* /p0*/N,PO&@Jg.Hx/ NNPOJf/ N-./ NTPO/ N-XOB`~/ N-fXO L N^NuNVH0EBB`( y"hF Jf"R%rn` Rmpo #D`/9DN.:XO&@Jf`B+++BHx/ N (Jf``/*NXO @ BB/ N *Jf`2/NXO @ / N,XO D!E E!D n n p`/*NzXO/ N-XOpL N^NuNVH0$n /.NrXO @f g o*. .ڐ-@"¼f& .SJo"/ yP"hNXO` SJg JRp/ yP"hNXO` .SJo"/ yP"hNXO``` / yP"hNXO` / yP"hNXO`:/.NXOL N^NuNVN^NuNVH0,.(. &.G>Jfp` g&. *pFbB A$p`& :g %f`HH//NPOJl`PRf %fHx:/NPOJmHx /NPOJl`" HHм0 9o^ HH//NPOJl` HHм0 9o^ HH//NPOJl`HxH/HxHj$Hk$NJ HxHj.Hk.N6 HxHj4Hk4N" HxPHj@Hk@N L N^NuNVH0&n$n  KR JRSJfL N^NuNVH0&n$n p+rfp/#Dt `$/ Hx / N: Jgp` DpL N^NuNVN^NuNVH0G$n p&'@A'H/ /.NFPOJg`Jg p#D` p.$p`pL N^NuNV/ Gnp&r'AA'H/ /.NPO&_N^NuNVH0&n E//.N=POJgp`8B%S%n/ /.NPO. *JfJg ` p#Dr L N^NuNVH0&n EB%S%n/ /.NHx/NNPO# Hx/N߸"ҹ #$5k(p5@*%y ,L N^NuNVH0/.NrXOJlp`h/9NXO.Jlp`RBHx/.Nt &@Jg./././ N $@Jg/NXO @ n B`|/ N1xXO L N^NuNVH0/9N XO.Jlp`RBHx/.N &@Jg./././ NN $@Jg/NJXO @ n B`|/ N1XO L N^NuNVH0/.NXO&@Jg"$S g/ NLXOJfBp` `p#DpL N^NuNVH0(.z/.NrXOJlp`/9N4XO.Jlp` @gp`p,B//.N &@Jf`z gF/ // E"hN`>`:Jf.9D/NNXO,Jg/./ // F"hN` `p"#DpL N^NuNVH0$n /.NXO&@ fp`pg$p WDfp+rWDHH`pWDHHJgp(#Dr `2p+rf^<+ f y<( /NݶXO*Jg(/ /pg E (` E ( @NPO`p(`p0+ /p0+/N JPO.fp`pg,pf G +dp(#D/N XOp`t/N XO%k p+rf$/ / /pgAZ `A<  @N `/ /pgA `A*  @NPO(/N .N PXO'j  L NXJf/ N./N!PO&@Jf`/HxN0 Ы$@0*Hg@ .gr2*WDHH`Hx/./ ND JWDHH"Jg``pf, Eeb/ NXO Ed n p`( n -Hpf"`" n p` / NXOpL N^NuNVN^NuNVH0&nA -HHxNvXO-@ KRg r%fB -fR 0fRx0`x B`"Hx /.N KRHHП0-@ 0m 9o .f@ HH//NPOJl`&`Hx"/NPOJl`Hx /NPOJl`p`pL N^NuNVN^NuNVH0E&np0 g/ HyHxN~ N۔`jHx/ y/(N$ Jf*/NrXOJo y/(*/HyHxN/ HyHxN /9HxN0POL N^NuNVH0&n$n p0+.p@ovr2//+"A/0/ Hy/.Nhp0+r Qf0p0+A2/0/+ Hy/.N*ZPO. *JfJg ` p#Dr L N^NuNVH0&n E//.N rxf,S м0pr9d' &Jf`SA ".ڒ-A fV g& t0f"JRp/"yP iNXO .SJo"/ yP"hNXO`A o"JRp/"yP iNXO` .SJo"/ yP"hNXO``x n$PXB-J`R .Rrg:p0+ /p0+/NPO*pf "€gp&#Dr `NJ$@Jg5k5k 5k" p+@pf%kp*rgp$X娀@p+rfp0+"/NXOJf&p+rf/p0+"/NPOJgB* L N^NuNVH&nB` kF Jf `Rmp#Dr LN^NuNVHB&y `6+g,p0+ f p0+fp+rgp+ $m LN^NuNV/ &y `p+f` $mp#Dr `Hx/ NPOp@" &_N^NuNVH0&n$n HxHjHkN^ pfN`Hy:NXONtL N^NuNV/ &n JmHn/ /.Ne `/././././ N&_N^NuNVN^NuNVH0&|,<$| F> @g n1|c`~ f` Fp`0"¼ g:`4 F> g  g:`4 np0S1@ F0666 Fp@06c6@ nC& x` C XSJfL N^NuNVH0$|,<4A nG~` F XSJf n4L N^NuNV yN^NuNV yN^NuNVN^NuNVH0GElHx/9/9N /NPO#HxN& &'G`p߫`jc`f`\p0+ /p0+/N#XPO$@ fp`L,*/ N#XOJ m Ї'@`e '@```p"#Dr `p` p#Dr L N^NuNVH0/.NXO&@Jgp0+ .p+U@gS@flg:Jf yp0(./NXO,Jg/./. / F"hN `<`8Jf.9D/N\XO$@Jg/./. / jN ` `p"#DpL N^NuNVH0(. &nHx/.NzPOJf/.NXO$@Jgp0* .p*U@gS@fg|Jf yp0(.  f2 g r` Jg /N"XO&` /N~XO&p`d/NXO*Jg/.0 $n&n*+Jgpf + fbB Bj DJf` D/(NhXOg pf`NJg`/ N:.Nh^.NXONJg`p`f/+ / NPO,fp`f/+ HxN˴./ F Ш/ * "<c * ` </N /NѬXO`p` p.#Dr L N^NuNVH0,. $n&n e: FJf`NJg`/ Nb.Ng.NXONJg``'j Jg FJf` UDf/+ HxNJVDHH//+ / N .fp`/+ HxNʖ*/ G Ш/ </N Gh/NФXO + c g SgSf&g Rp0(&`& Rp0(&` Rp0(&`p"#Dr `pL N^NuNVHGp f Sr2(gr#Dt `p . gSgSgSf,g$ Sp0(.` Sp0(.` Sp0(.`..``. .g SgSfg S1G` S1G` S1G``p`pLN^NuNVH0E&n .g SgSf&g Rp0( &`& Rp0( &` Rp0(&`p"#Dr `pL N^NuNVHGp f Sr2(gr#Dt `p . gSgSgSf,g$ Sp0( .` Sp0( .` Sp0(.`..``. .g SgSfg S1G ` S1G ` S1G``p`pLN^NuNV/ &n y`0/NXO&Jf` gj/ Fp0(/NPO./ N^XO G .Hx/.NŌ"Ш&@$G`rJf6/NPXO&Jf`2 gj/ Fp0(/NˌPO./NXO/ NXO ` / NXOpL N^NuNVH&np0+/N8XO.g R$k LN^NuNVN^NuNVH0$n../ NrXOJl` yp0(g p#D`npgrg t"#D`XBHx/ NӬ &@ f`@/ N XO+ + . ሀ7@"k/ N.NXOp`pL N^NuNV/ .ሀ .pf/NXOJgp`p`(pf/NҐXOJgp`p` p"#Dr .@`p+"F@`nHxHk(/ N$ .`XHxHk./ N$ .`BHxHk4/ N$ .`,HxHk:/ N$ .`+ g+k/ NXO L N^NuNV/ &nHn/ N.NܸPOHxHn/ ND Jfp` p"#Dr &_N^NuNVN^NuNVH0EN0NHx /N KRHHП0. 0m 9o  fR`gp` LN^NuNVN^NuNVH0E4HxHx/9NN|PO$Hx/9N В#8&R`Hy 0/ N"PO 8m 933#L N^NuNVH..,. //N\POJfp`//NPO&@Jg80+Hgk/ NJXO`0+ Rk f/ N!XO`8Hy%k j`Z F/(Ng&XOp`@/9HxN0POJfp/#Dp` FJg F/(NfXOp.#Dr L N^NuNVH0..&n$n d ` +.f`hpg//+/ Nʨ `Dpg.// NLPO. Sr2p g "St2f// /+Nb ߫߫ L N^NuNVH&n~`pr gpf` RR e LN^NuNVN^NuNVH0/.N"XO&@Jg$S fp#D L N^NuNV .d y"hFA" ` p#Dr N^NuNVH0&n.. /HxNȔ.p+rf/p0+"/NPO$@`~pc ",3@`Rz0(H&p&_N^NuNV/..l yp0(gp#Dr `p(l~(`pذo~ y1Gp.N^NuNV/ &n yp0( &p&_N^NuNV/ &n yJhgp#Dr ` Al&p&_N^NuNVBNtXONpN^NuNV/ &n9 HH9 HH&/98NXOJgp9#Dr `p&_N^NuNVH0*.&n$nB . k nH0;N&>JVbnzrHx/HkNb .`Xp0+$`Lp0+$`@p+$`4p+$`(p+$`p+$` $`p+$`p0+ $`<+`Hx/HkN^NuNVH0$n/ NrXOJlp`LHnHx/ N &@ fp`0/ N.XO++7n k/ NF.NXOpL N^NuNVH0HxN4XO&@Hx/ NPO$@Jg Hx/ N۾PO//./ Nb .`~/ N4vXO L N^NuNVH0E/.NrXOJl`BHx/.N &@ f`lp+rg p#D`HHx/ N5POJg`6 R1k R1k  Rp0(f R1k R1k / NXOp` / NXOpL N^NuNVH0$n/ NrXOJlp`@BHx/ NX &@ fp`&/./././. / N L./ NlXO L N^NuNVH0~/.NLXO&@Jg8p g` r . ,HxHx//NJg`pHx///NJg`X///NP BHx//NV R r 㨑.#( #,#D0HxHxNpPOp` p"#Dr L N^NuNV/ GY/Hy PO&@ fp`0 .Hx/.N>"Ы @./ NXO` LN^NuNVH0,.&n .SJgJg/ Fr2(/NPO.f`(Nb .`Hx/Hk.Nb .`Hx/Hk4Nb .`Hx/Hk:Nb .`<+"`6<+" f(p+rf yp0(` 9D< $ n  `"p+VDHH$` p"#D~ L N^NuNVH0$n&n*.,.B . Skp nhH0;N@@$$$`````@@@@``. ̀ y0+hf`0 yp0(f` p#Dr `(p"#Dr `/ NXO . Sk nH0;N$,4J`t7F`7F`p+"F@`p+"F0+ /p0+/NPO$@Jg/./././. / N./ NXO L N^NuNVH0$n/ NrXOJlp`@BHx/ NЎ &@ fp`&/./././. / N P./ NXO L N^NuNVH0~/.NXO&@Jg8p0+ /p0+/NPO$@Jg/./././. / N ./ N$`8p0+" fr `p37@$7@ "9D7A7@B/N4PO.Jfp`Hx// N( Jgp`HxHxHx/NZHxHxHx// N r $@Hx/ / N4 'J*'|.A'H#A C // Hy Nb BB/+/ / NA0/ NNXOpL N^NuNV/ &y߮`"0+HgBp0+/N6PO ߲m&_N^NuNVH0GǔEHy NXOHy NXOHx / N^PO/ N XO.SfHy NXOHy NXOHy FNXOHy tNXOHx / NPO/ NXO, ሀL N^NuNVH0$nGPBS S"hN.r gf0 POJg//N:POJg`/N|./NpPO&@Jfp`p+g / NXO`>/ NXOHxHkNXPO y7h y7h 09H@09J@09L@+7k Hk(NXOHk.NXOHk4NXOk/ NXO L N^NuNV/ &y4`8p0+f(0+Hf0+Hf p0+ fBk 8m&_N^NuNV/ &y4`VJg p0+f@0+Hg20+ Rk f/ NpXO/ N.N.N .NXO 8m&_N^NuNVH0&... B,94`, Fp0(fJg Fp0( f Fp0( ؀8m$y `$*gЀ/HxHxHxBNJyXgHyBNq"POpL N^NuNV/ &nHx yߜp0+HpNTPO&_N^NuNVHBBB`4 yp0xrfJf  g`*Rf ``BRmp#Dr LN^NuNVH..,. ܇o/Hy NPON`" yp.F0x y.0xRnLN^NuNVH..,. ܇op`,`$ yp0xr.r.gp`RnpLN^NuNVH0,. &.(.g:< yߜ"Dp0)G` :<Gֆ .`2 Jsf&N^$@JgHx/ NPO " 7``xR n`2 .N^NuNVH.. /.N XO&@Jgpbr2+e ` p+#DpLN^NuNV/ &y4`.p+gp0+ fp0+f ` 8mp&_N^NuNV/ &y4`^p0+fN0+Hg@0+Hf20+ Rk f/ NXO/ N.N.N.NHXO 8m&_N^NuNVN^NuNVH0&n E pp. . A"g" f %r `pL N^NuNVH0$n .Apg4p0+fJg p0+fRp0+fJg p0+fR m*9߮`4 E0(Hg Ep0(fJg Ep0( fR߲m L N^NuNVH0,.&n*. / NXO0+Hg/ NXO/N$XO.Jf`t///N $@Jf`^Hx// N:PO @HhHkN / NTXO7F7E kk G0(Hgk/ N2XO `/ N&.NXOpL N^NuNVH0&nk0+Hg`p0+/N#PXO.Jg/p0+ /p0+/N$ $@Jf0p0+ /p0+ 7r23$A"¼$銄5RnJyZg*Jf / BNoPO` DJhg/ Dp0(/NnPOp`F .`* Jsfr23$AJg/ NXO BsR npC#Dr L N^NuNVH0(. &.*.g yߜ"Ep0)G`Gք.`$ , r23$A"¼BrRn ,`F r23$AB` Jrg` R m f/ NXO BsBsR nJyZg*Jf / BNmPO` EJhg/ Ep0(/NmPOL N^NuNVH0$n g yߜp0*G`G . Ѯ.`B * r23, F"¼t4.N^NuNVH0~@A| м$@ SJg $ J&H`#ތL N^NuNVH0&nHxN"XO, f`fJgpf>$yތ f`N#ތJf BA'H` +. G ѐ$A'H +R @R/NXOp` /NXOpL N^NuNVH0&nHxNXO,Jf`Z +R @SJgpf. +S$@Jg. G GX'H$ތ#ތ/NNXO ` /Np+f0p+f"p+fp+fp $`d`fp0+fp+f`HJgp0+fp+f`,p+f`p+rfp `p $p`pL N^NuNV/ &n k S!k&_N^Nu/p0+/Hy 8N`BHxHkp0+ // N0PO @HhN j/ NHXO` Hy `NXOL N^NuNVH0,.*. /N.N"XO$@Jgr~`V/ //Nn &@Jf`>// NPO @p(f E"E0)^Ri^A`1/ NXORp0*e Ep0(^rPbL N^NuNVH0,. $np0*eJfp+#Dr `( S/HxNp0*П.//.NjPO&@ L N^NuNVH0$n |C *&@ . S/HxN " Ҁ L N^NuNVH0Hx/.NPO&@ fp`:$kp0*^rPc 0*^Rj^A`1k/ NXOpL Fp F"¼4.pRmJyZg& f / BNm PO`Jjg/ p0*/NmPOL N^NuNVH0&n $nJfp`< r . .SA ,Hx R/// N(L N^NuNVH0&n $nJfp`< r . .SA ,Hx R/// NL N^NuNVH&nJ fp`@ r . . SA ,Hx R///9NlLN^NuNVH&nJ fp`@ r . . SA ,Hx R///9NLN^NuNVH0(. &. .g yߜ"nr2)C" ` >Jfp`R S +R @p&_N^NuNVH. &n N>^ +R @R SJWDfpVDg  WDfJWDJgp`pLN^NuNVN^NuNVH0E>.&n Rp0(fp`\ R0(Sg0 R0(kg$ H> R0( kg R0( kg H> r2+gp` p:#Dr L N^NuNVH0&n,. *.f8B`p0+g``R Ю&@mp;#Dr `B`vp0+gX fP  fp<#Dr ` r2+Fgp:#Dr ` nB `` f$KR Ю&@m fp=#Dr `Xl|/Hn/.Ne Jgp`&yߠ`0Hf f$K`~ +grp0+fh/HkHnN JgR g0Hg`: gp0#Dr `/ NXOJgp`vS/ N.XO`d ߤm` fp2#Dr `D%yRR gR5EB`o 6xHH`pxRpnpL N^NuNVH0E.. pg yp0($`p,pl~// /.Nc Jgp`&yߠ`z0Hgj +f^0HVDr®VDfB/Hk/ N8 Jg.p0+f$0Hg S/ N-VXOHx/ NPO 1 NVH0&n $n%k$ k 'JL N^NuNVH0$n&R fp` / NXO L N^NuNV/ &nJSg / N(jXO`p6&_N^NuNVH&n>BSJGg/ N(XOLN^NuNV/ &y`pgp0+ f ` mp&_N^NuNVH0$n G.. r .pg g` r ,HxHx//NJg`Hx///NJg`///NX BHx//N^ r . S.p`A r /./NPO,Jfp`z///N Jgp`dHxHx//NHxHx///N n r ./ nN Gh GHh&NXOJg p.#D`/.NXOJf p>#D``pL N^NuNVH0E/.NXO&@Jf`t . gSgSfPg R0(Sg R0(kg RJhg`4Jg/+B/ N `Bk$ 9ЮHlBk p0+ p` p.#Dr L N^NuNVH0 nEpNÊÊ n&J!J&&7| @BkFA'HB'n H'n$7|LL N^NuNVH0&nE/ /.N\POJg~`H/N$XOJf2B/ NPO&@Jg/ //. nN ./ NfXO`~`~/NnXO L N^NuNVH0&nHnHn/. / N%(Jgp`4/./ NPO$@ fp`/./ /./ N/ N HXOpL N^NuNVH0&n/ ND.NXOHnHn/. / N$Jf/./ NPO$@Jf@`@NB'nB` BjRpn'n~` ABRpn'JpL N^NuNVH0G$n S//N\, Sߨ.p` p"#Dr L N^NuNVH0:.&nE,. RJhgp#Dr ` &@ f gp"#Dr `fE r . , f///N `2///N Jgp` /Hx///NpL N^NuNVH0&n $nB`(l JRHH`p KRHHgp` RpnpL N^NuNVH0$n jpg< j&h: ߠm ߤm` +fp1#Dr `$K`pL N^NuNVN^NuNVH0GElHxHx/NNVPO#߮Hx/N"ҹ߮#߲5k4p5@6%y߮/Hx N Zp0ПSn/Hx N T*f gSp-`> rxf,S м0pr9d' *Jf`SA ".z-Ar fN g" t0f"JRp/HnNPO .rSrJo"/HnNtPO`A o"JRp/HnNTPO` .rSrJo"/HnN2PO``v n$PXB-J`R .R @f g vo(.v .z-@r"¼f" .rSrJo"/HnNPO` SJg JRp/HnNPO` .rSrJo"/HnNPO``` /HnNfPO` /HnNPPO`NXO$@Jgp0* ,p0*. Ep0* `p` //N`POL N^NuNV/ &y߮`0+Hf ` ߲mp#Dr &_N^NuNVN^NuNVH0EHxHx./* N4NQ$PO#߼HxHx/*NNQPO&@/Hx/NPPO/NPO#߸B`&#Rm3p.3#߼L N^NuNVH0$n HnHx./9/9߼/./.N&@Jfp`dJg2BBBk,Bk*Bk&Bk$ 97@(BBN'@ p0+ //9N2 ߼/Hx.NP П$pL N^NuNVH0*.../.N6XO&@Jf`Hx/ NPOJg```` HH/HnN6PO` HH/HnN"PO`&HnN>XO .`pL N^NuNV/ &n m/ NXO R @&_N^NuNV/ &nJf* o" -@/+Hn/+ N '@&&_N^NuNVN^NuNVH0GlEHxHx/N N@PO#Hx/N "ҹ#7j7|'yL N^NuNVH0$n/./.NPO&@Jg:/ Hy/ A/N$.f n p0+ `/ NXO`~ L N^NuNVH&n/ Hy/9A/N. yp@f ` /9DNXOLN^NuNVH0$n/ NDXOJlp`P/./.NXOJlp`BHx/. N &@ g p+,p0+"./ NXO`Dp`fpg#Dr `NJf.9D/.NYXOJlp`0HnHx/.N. &@ fp`p+g p#D`Hy߬NR.N XOJg#D`N$@Jg5G5k5k 5n jpgj/ /N:POJg D`jpgHxHxB/Nj`Hx/NtPOg p,#D`jHy߬N.N|XOp`"Hx/NPOHy߬NXO/ NXXOpL N^NuNVH0$n>HnNlXO .L N^NuNVdH0E&n A(-H-H-N-nB/ NJ,XOJl`&K KRg %fB -fR 0fRx0`x Bz`"Hx /.zN KRHHП0-@z 0m 9o .f#D`hp0+$Їr2+(d6 g p?#D`@k/ NDXOJg p.#D`"`Jf6 g p?#D`HyNXOJg p.#D``bJgJ/Hy߸NPO,Jf6 g p?#D`Hy߸NXOJg p.#D``Jg// n HhNS Jg`tRk&k$ y7h *N'@$y#B%n5G%F Jf 'J'J` k 'Jp0+gkHk&NXOp`pL N^NuNVH0(.&./.N6XO.Jf`Hx G/NޘPOJg&@Jg8/. / / A/Nb.f np0+ `/ NXO`~ L N^NuNVH0$n &n/ NDXOJlp`6/ / /9A/N. yp@f ` /9DN XOL N^NuNVH0E R1n N NNNF/Nf.NXO&y`2pf`& R0+ h"f/ NBXO R0+"h fp7@" m/9N.NXON L N^NuNVH0$n <,B&y`2pg( y0+"h fp0+ gJf p@g`D~ mJfJfp#Dr `lN0bJf/9N XOJg`F` y +6Ы22+HЁѨ6p0+ $ n0+H n1 N g/ B/ /N L N^NuNVH0*. &n/NXO.//NPO, R܀ +򐆐@$@// / NL Jgp`F/ //N JU'H7GHx/ / N Jgp`HxHk/ N H L N^NuNVH&yBG`bpfVHx/ N PO7G/ NNXO y //9N C'IF 9//+FN PO `RG mp!#Dr LN^NuNVH0ERRp0f`&y`pg 0+ Rf` mp0L N^NuNVH0&n $n5k5k5k5k 5k 5k5k5k5k5k5k5k%kgp0//0+H/N( #DJDgJg////9N`0+RJjgBjHjNXO`0+Hlp02+HDbn0+Hg>p0//0+H/N #DJgJg////9N@`z0+RJRgJjgBjHjNZXO`Jg"////9N#DJg`20+Hg p?#D`RjHjNXOJg.0*SjreBjHjNXOp.#D``JRgJg"////9Nx#DJg`0+Hg p?#D`RjHjNXOJg,0*SjreBjHjNXXOp.#D`N`tR\nNVH0$n*.(.Jf y`:/. NjXO&@Jg& <gp0+f HkNzXO` .Sk nH0;N6\r/// N .f// /N8 .`/// N .f/// N8\ .`HxL/ HkjN8 .`t<+HxLHkj/ N8* . r2+¼7@`:kBkHkN XOHkNXOB`/ HxN"POB```` ` p"#Dr L N^NuNVHG S <g< Sp0(.Jg. S SJJf Sp1@N Sp0(rb SBhLN^NuNVH0E R <g Rp1@N RB$k`,HxHn/N) Jg` nc`TRPp0+bB$k`RHxHn/N( Jg`h4JngJjgBjHjNXO`JjgBjHjNXOTRPp0+b EBp`p"#D`pB#D`p:#DpL N^NuNV/ y/./9N 2 "HAHABAЁGp0+g/./9N  k gp"#Dr ` &_N^NuNVH0:. fp` E@n H lpB` y"yp0)&p f0&y g # y"yp0)!`p;`DB(E`< * m * f 0*nd` * f 0*nfx`RPp0+/* N N-PO#Hx"9/N-PO#"*\,Hx/*/N N-PO&@/Hx/N-rPO/NPO#B`&#GhRm3p3#L N^NuNVH0 y"yp0)&p f`p0+SA.`x G/(N XO(Jf`b D"h Gp0(Ep0 G2HЁ*m o`44JRfJjgBjHjNXO GJPoJjgBjHjNXOQA o~Bk  f# `,9 ` F f F ` F,Jf&# y"yp0)JL N^NuNVH0..HnHx/9/9/./.N&&@Jfp `cp"#Dr `. n p0+ //*N /Hx*N  П pL N^NuNVH0E y"Rp0)//9N C( B` DJf` RXm캹m p;#D`Hx/.NPO&@Jf`Hx/ NPOJg` <fHx/ NPOJg` <r , <Ы.///N\ Jg`HxHx///Nhp0+g& <Ы//+/N k <gBHx///N D Rk(N'@ R7h $ n p`pL N^NuNVH0 y"yp0)//9N EB`&R g +L N^NuNVH0G$nBHx/ / N= Jgp`JgRXJf L N^NuNVH&nB JgR` LN^NuNVH0G$n BB`2Hx/ JX/N< Jgp`/N;XO*Jlp` ޅRm L N^NuNVH0$n BB`" &r KRgR` T.Rm L N^NuNVH0*.&n (.&K "ҀX$AB`" D !,3 JR R"@g`Rn D BL N^NuNVH0(.$n ЮX&@B`2* % n ,0 E"FgRRR` T&@Rn BL N^NuNVH0(.,.&n &.$D JRg` * S.` B&y` F"hp0 y3 R\n F-HN, n!@p`pL N^NuNVH0*.&... (./NjXO&@Jf`T .k0 n&H0;NJ@^ y0(Sg y0(kg yJhg`p0+/B/N B$k`2BjBRJjgHjN#D`Hx/N /9/. N/ Jg`vBDB&y`@ F"hp0E0+Hop02+HЁ c pB#D`,0+Hf` RXm⾹m p"#D`N <Ыr / <//9Nh / NXON'@ y7h $Bp`pL N^NuNVH0Ep fr` <"//.N"PO&@Jf` . gSgPSfg R0(Sg R0(kg RJhg`Nr'@ kB Rk(/ No S (>nB`( SJ>o S (>`p. S S!R>N S (> SJ>o Sp0(f/NhXON` S S (>ђ S!G>N/N XO Sp0(fp` p.#Dr L N^NuNVNZJf /9NXOpN^NuNV/HxN |XO.N" y!n>N/N  JRgR` L N^NuNVH&np<,p+.rc  S`WHxm/N П"Ёr+ЁAr0x*/<Q/N p+Пr+t+Hxf`@ +>4.lB'G>Jfpg / NXO` / HxNPO` Jgl$ mB4L N^NuNVH0&n м$@`0nfp` T npL N^NuNVN^NuNVH0E RGj R/NXOHxHn R (T/N .f $p0.rQf=k0.k @[n H0;N2JZ( <Tv6Tr .T~ ">`Nj&L\p .8Z n   2 < V t p0+ /ppl&*+"'s'/ / S//N|`L N^NuNVH0&n $n/./ / Nh Jgp`/./ N POpL N^NuNVH0&nB "<.// N|POJf$KЇ`RJf ` RSJf`pL N^NuNVH0&nB "<.// N&POJf$$KЇ`RJg  f ` RSJf`pL N^NuNVH0&n$n /./ NPOJgp`/./ / N H pL N^NuNVH0$n&n /./ NPOJgp`/./ / N H pL N^NuNVH0&n,. $s І. nZ l R/3 /3 nNPOJlR /3/ nNPOJl$np0+/p0+// Nb Jgp`Hx Hxp0+/p0+// N`Bp0+ /NPO.Jf`p0+ /// N Jg`HxHxp0+ //N8HxHxp0+ /// Np0+ r / // Nh p0+r %@*p0+ %@.p0+ $Ԁ%BRk y$p0*! n n  p`p0+/p0+// Nx pL N^NuNVH0&n&.Hx NXO,HxNXO.BB/. N9 /Hx /. N` Jg`Z F-h F-hB F <Шмr *B/NPO(Jf`///N Jg`HxHx// /p0+/NJ.`/+$/+ N1PO.`/+$p0+/N2NPO.`p0+ //+ NMPO.`p0+ /p0+/NMPO.`Hk p0+ /p0+/NK .`/+ p0+ /p0+/NLT .`x/+Hk /+NX .`^/+/+ /+ /+N.`@/+/+Hk /+ /+N.`/+ /+/+NR .`Hk /+p0+/N: .Jm'GB`p0+/Hk /+p0+/N;J.Jm'GB`/ Hk HkHkNNN.`p0+/p0+ /p0+/NN .`jHk HkHkNOJ .`Pp0+/p0+ /p0+/NS! Jp f SBhp` p"#Dr L N^NuNVH..&n plr"#Dt `bp0+gpg`P fpWDf rWDJf`,p@g`$ SrJf`7Gpg /+:NގXOpLN^NuNV/ &y`Fpg< g2p0+ gpf/. HkNPOJg / /.N&PO m&_N^NuNVH0 yE yG`0n fp`*T n yG`p0f6 `T npL N^NuNVH0 yE yG`0n fBSp` T npL N^NuNVH0E Rp0(.Jg, R S&pJ g R Sr!J` Hx.NΪ/ N PO &_N^NuNV/ . Sй,&@/ /. N Z ËË/./ N PO &_N^NuNV/A<#HC#,NNNN+NDN(NNNN@NTN@NhB`@ ATJg."C/1/1$R/"p iN Jgp`TRp nB`> AJg,"CNvJg p.#D~`*` <gJf`/ NBXO.Jg L N^NuNVH0$n &n~/ NXO,Jm$// N LPOJg`NJg p.#D``BHxNXO*pfHx/ k@NPO/NXO L N^NuNVH0&n$n < dmgf gk m 9ѓ B@lp`B@R <@g$Hx/ NPO/ NXO/ N XOp`// NPO@`Hx / NPO` gpg`pp`np+P@r.tc&r.AJ0gr.pf fp`(p.rfp`p @p.ApL N^NuNVH0HxNXO* .A\$p&j, @g8p+. g`//NPO.Jl`//NPO`/NXOpL N^NuNVHHxNdXO. .A&pHx /+NTPOHx/N`PO/N:XOpLN^NuNVH.. &n < fR <gg( c`Rpnx&p+P f`$`Hx/ k@NPOJg`Hk NXOp` p"#DpLN^NuNVH0&nEHx/ NPOJf(Hx./ NPOJf . gr9`p8"// NPOJgp`pL N^NuNVH0.Ev&n < g HH// NPOJg`j`b  l HQ@k @nH0;N"rP <!gHx / aPOJg`+Nf` HH// NPOJg`B+N`B+OpgHx / aDPOJg`R+N+N+Ve6B+N+Vg, <! fHx/ NPOJg` <@gp `p // NPOJg`r+Vgp+Nr+XЁr+VcXOBF~`RF . TfT D1FJyZg$ yߜ"Dp0)Hp Dp0(/NPOL N^NuNV/ &nJkgpr2+FTBk&_N^NuNV/ &nJyZg& |-H <gp`p0+ n1@&_N^NuNV/ JyXgdJyZf\p3Z&y`*Jkg yߜp0+Hpp0+/NHPO m/9N`XO |1| &_N^NuNVp09Xr29Zg |Bh ByZN^NuNVJyZg |1| N^NuNVJyZg |Bh N^NuNV/JyZg |>( .N^NuNVH&|B`47Gp0.F". ㉀".ቀ7@ TA0H nH0;N*l8HxZp+P$` <$` $` r$` r$`p+Q$`+RHH$`t+SHH$`h+THH$`\+UHH$`Pp+V$`Fp+W$`f`g`V Ar0 gp`4`* Ar0 fp` LN^NuNVN^NuN |NN NNhNN|NNNNDNNbNNNN"NgNNNV/ &np @&_N^NuNV/ &n&B/ k@NPOJgp`p&_N^NuNVH0E @&nJkHf <g:BHk0NPOHk NXOHkNXOHk$NXO&BB+N`` <@g` HH// NPOJg`*B+O`+OgS+O`,kWO+WgS+O+NgS+N`kVN+VgS+N HH// NPOJg``zpg@+Wg+O+We <@ f`"Hx / a POJg`p+Of`P+O+O HH// NPOJg`l` HH// NPOJg`V`P+Wg2+O+We(p f" <@gHx / aPOJg`"`p`R+O HH// NPOJg`p`pL N^NuNVH&nHxNXO, < f"pg / NXOJg``p./Hk$NPOJgHk$NXOJg`P`pfHx/ k@NPO/NXOp.// NPO.0pnLN^NuNVN^NuNVN^NuNVN^NuNVHx N6XOpN^NuNV |p@f` |pN^NuNV |pf` | |pf`pN^NuNVN^NuNVpN^NuNV <fp` p #Dr N^NuNVpN^NuNVpN^NuNV/.<`/. NXOJlp`"SJfBNxXOJgp.#Dr ``.N^NuNV/ &n < f p&r ` p"#Dr &_N^NuNVp"#Dr N^NuNVN^NuNiNNV/ &n/ 9й/ N ,XO.Jl`/ N XO.Jl` r f`Hk NXOS+Pp+P bp+P3 `B/ aTPOJgp`SJfp`/NVXOp.#Dr LN^NuNVH&nHxN&XO, < f"pg / NXOJg``p./Hk$NPOJg2pEgHk$NXOJg`J`Hx/ k@NPO`/NXOp.// NPO.`B/ aRPOJgp`SJfp`/NvXOp.#Dr LN^NuNVH0.E&n g g+Rf: +RSf Hx/ NPOHx / NPOHx/ NPO`+SHH// NPO`x  f Hx / NPO`f  f( <g`pg Hx / NPOHx / NPO`8Jm&  l Hx^/ NPO HHм@// NPO` HH// NPOpL N^NuNVAC, "F$i .+"Fp)g:0+Hf,p0+ /HyNPOp7@/ NvXO`p0*c"BkB+ @7|/ NPXO` Fd~p0*/Hxp0*/NFNH./p*/N @/p*/N.R/p*/N @/p*/N 7@7|/ NXO`L f6BkB+p0*@p*/HxN 7@/ NXO`p7@/ NtXOpL N^NuNVH0&np0. AC. "G$i < gYg*Sg2SfDg8/ NlXO&Jgp`@p#Dr `2p0*(&p`&p0**&p`lHk N>XOJg`H` < rf,p< c$$<īgHx/ NPOJf/NXO `/NXOp.#Dr LN^NuNVH0&nE+S Rf2Hx/ NPOJg`:Hx / NPOJg`*Hx/ NPOJg`` HH// NPOJg`p`pL N^NuNV/ &n <0 gp`$ . fp` .f <gp`p&_N^NuNVN^NuNilN NhHNʾNN>NiNhNj(NN |N NJNV#pr N^NuNVp0. gp #Dr `RypN^NuNVSypN^NuNVH0&nE( +d*9/(NPO7@$N/NXON p0+$gSJf` Rk(N `/N|XOp0+$L N^NuNVH&n~ +Cxf +Lyg +Cxf +Syf +Dzf +D|f LN^NuNVH0$np0* A&p p/NXO#'Jjjj'jp0*'@ 9N@"B+&A #LBN XOL N^NuNVH0&nE(9N,</ NXOHxNTXO*A"%H%J Hx/ NPO/ NXOJg B/ NPONZ. Fp(4 Fr(07@$p0+$gSJf` Rk(N `p0+$gB/N.N XO L N^NuNVg`$p0*f pgp+g``" gp `p0rt婀@#G/ NXON'@N(f/HyRNPO` g Jn f Jl/HytNNPO`JB+B+B+/ N^XOfp@'/ N$XO`p0+$@-@r® g&r2*frAAp@@7|`/ NxXOgp@'/ NXO` k/(N XO, gp0*f pgp0+g`z`> gp `p@ g* g *B*`p@ g*p@`p@p@"¼VDA+A z `A x  @NPOJgp`6/ N HXO.* p0+cB+B+ @`np0+/Hxp0+/N N ./p+/N v @/p+/N z.R/p+/N P @/p+/N T @ F ( c *` F ( .'@'j 9N@"p0// NPO@' +/HxN ߪ/HxN .ߪ / NXO+'g/ NXOp#Dr `pL N^NuNVH0&n $np*6p*7@p*7@7jpL N^NuNVH0&n$|HxN XO(J+WDgJ+WDJgp+#`p+#@4p+AHpk3p@0H&nHxNdXO,p./Hk$N POJg`LpfHx/ k@NPO/N2XOp.// N4PO.`B/ aPOJgp`SJfp` /NXOpLN^NuNVH&n < gB`p.Qkx npH0;NVhB0p+Q.`Lp+Q.`:p+Q.`(p+Q.`p+Q.`B LN^NuNV/ &npfHx/ k@NPO&_N^NuNVH0&nE <g HkNXOJgp.#Dr `0` d/ NXO.Jl` <0 f g g+RfTHkNFXO.JlHx/ &Np`/ /. /N L N^NuNVH0G(. &.p0. AC* "E$i "C, g [kz npH0;Nhjfff*<N g`ZHx/ /N Jgp`L/ / N(PO.mHx// N Jg~` g` Ep(g*p0. /HyNPOp#Dr `Hx / /Nz Jgp`/ / NPO.` g`Hx/ /NB Jgp` Ep(g0J+f*p0. /HyNJ+f$J+f,<p0+*p+R@`&p0+,p+* k p+r0RAk2HxNXO&Nj3J g&~p+AJp0//+NPO7@$`$~p+ALp0//+N8PO7@$NX/N^XOp0+$gNh``ݫJfNTB`~R+p+c`B+R+++dp+AHp`B+R+N `S+"p+"f`&Rk(Np @0Np0+$NPOJg``,pg&/ NfXOJg`p o/ NPXOJg``r+TfBHkNXO.Jm.pg&/ N XOJg`Vp o/ N XOJg`@``* f ` < fpg&pA_Dg rZ\DJg м ` .pg  f4 <rf$Hx / NPOJg`Hx / NPOJg```  f <fHx / NPOJg``<  l(Hx^/ NPOJg`r м@// NPOJg`\`// NPOJg`L  f <rf~ /HkNPO// NRPOJg``HkNXOp`HkNXOpL N^NuNVH&nHxNXO.Hk NhXO,Jg`Hx/ /N Jgp` Ep(g.JSf*p0. /HyNPOp#Dr `/ /NPPO.mHx// NR Jg~` g`z/ / NPO.mHx// N Jg~`P Cp0*( 5F(~`> Cp0** 5F*~`,Jf`* C N#N~`/.///N. ` p"#Dr L N^NuNVH0&n$|,9NHxNxXO.p@0N p0+$fSJf` Rk(k#4`/NHXOp*@WD@p0+$L N^NuNVH0&n$|*9NHxNXO.p+#@4yHp@@2HxNXO,N|0Hx kNXOp0+ $p`*N$p` p09Z$p`/ /HyN L N^NuNVH,.*. &n gp"#Dr `f gUfDg .N& F"‡/NNXOp`6p.p09Z&JgN6`N6p`// /HyN(LN^NuNVN^NuN NN/N tXOE#/ N dXO L N^NuNVH0&n $np0+g^p0+ r2+Ё-@Jk WDgJkWDJgp*`p*".e p0+ r*cp0+r*bp"#Dr `p0+-@Jk WDgJkWDJg <`p0*".//N .//++gA H `A F  @NPOJgp``/ N XOkk k %G%kp+// NPOJgp0*$@j%p*7@ / N XOpL N^NuNVH0$n ,. F&h Jg F * ep#Dr `f *//*0g3 g`~/NXO L N^NuNVH0&n$|HxNXO(J+f&J+f p+#@4,<p+*`k#4p0+,p+*p+AHpk3p@0N>p0+$g~`+gp+` @@2p+AJp0Np0+$g~`p+R@@2HxNXO&Nj3J g&~p+AJp0//+NnPO7@$`$~p+ALp0//+N$PO7@$ND/NJXOp0+$gNT`ݫR+Jg`VN8B/NXO L N^NuNVH0&|$yj#4L N^NuNV/ Gp6/ NXOJSf&_N^NuNVpB` KR9RpnBG`,<-` Jfp`SgRRpngp`pL N^NuNVH0$n&jNp.<-` *Mf`SJfp*Mf`p**r*+L N^NuNVH0Bp0. * , AXJg$p"¼?GrAt+ļB*0gt4+f/ / NFPO(|Hx/ NPOJg(p f/ NXO#D~` +p'@`4p*%@gS@g@fg+`+ `+@'j&// NBPO` p #D~` p #D~Jfp gRk L N^NuNVH0p0. . A/ &nRk*p0+$/p+/p+/p+/p+/p+'/HyN&_N^NuNVN^NuN+LN'N(TN*N(NNurNuN,N>NJNN(NN,\NN |N N$NbNN,NN'^N ZNXN)N"N TN NN'NV/ &n A/HxN POJgp`HxBNPO .A!p&_N^NuNVH&nHxNXO.A// HyN Jy:fDJy8f Jg~` g`Hx/ /N  Jgp`v Ep(g:JSf6 / / ./HyHN p#Dr `,/ // Nv .mHx// N Jg~` g`/ // NP .mHx// N f Jg~` g`Hx/ /N 8 Jgp`/ // Nr .`z n C21H A1~NJNNNTNN NNTNvN |NNN NgN o$/H $|4"|30<x@?p18DED(<` fdjQ`R o$/H $|4"|30<x@?p18DED(<``fjQgf0g0Fg<f ED180IAL8NuNV/.BNJPON^NuNV/.HxN4PON^NuNV/.HxNPON^NuNV/.HxNPON^NuNV/ .AX&p"kN+Mg /. N|XOp+f/.HyNdPONd kNp kN+Mf`p+NPOJg/ NXO#D|`p+45kp5@5|// NPO L N^NuNVH0$n&n|p0*//*NPOJgp`/. / NPO.j7j'j kNpp+f`p+g/ NRXO#D|`0|Hx/ N*POJg+LHH/HyvNHPONH// NPO L N^NuNVH0$n&np0*cp0* ep0* r2*Ёrdp"#Dr ` p0*//*NPOJgp`/. / NPO.j 7jHx/ NnPOJgHx/ / N2 `Hx/ NJPOJgHx/ / N `lHx/ N(POJgHx/ / N `p+H0&y$|7n $p+&k @nH0;NjpJ+WDgJ+WDJgp+#`p+#@4p+AHpk3p@0rA&t `p0+$g p@'`J+f J+f+gp+`p+@`. k p+0g k p+r0`p+"Ak2p+AJp0p@&r `*3p0+$g p@'`ZJ+f"J+f.<p+,p+R@`&p0+.p+, k p+r0RAk2HxNXO*N k0(Hg*p@'r+AJp0//+NPO7@$`(p@'r+ALpX&p ?Ep gSjp0*gp g4/ / N4PO,p@Hx/ NPOJg/ N XO// NPOpL N^NuNVH0$np0* . AX&p ?C* "Ep)gH0*Hf: / / /HyNRp5@/ NNXO`NHxN XO,A// Hk2N JkHVDfJkFVDJfHkFN.NXO/NXOpL N^NuNVH0$n~p0. & ?( AX&p C, "<® k nI2;N^// N PO*Hx/ N"POJg/ N "XO#D~`:Jy:f.HyN0XO&@Jg/ p0+ A"pNXO` Hy8NXO/NXOLN^NuNV/HxNXO.Ry:Hy8N.NXO.N^NuNV/ &| .A4p1&_N^NuNV/ &| .A4". $.11&_N^NuNVH0$|Bj4j0JLg^/. yLNXO&@JgJ/ NXOJy:f.HyNXO&@Jg/ p0+ A"pNXO` Hy8NXOpL N^NuNVH0&n$n p0+ .p0* , g gf +` L N^NuNVH&||0HxN\XO*N*HxBN&PO(Hx@BNZPOp`Z n C21H A1~`:Jgpl`2/.Hx// N8.`/././/N . ` p"#Dr L N^NuNVH0&n$n|/. / NPO.Jg <@Hx/ N ZPOJg/ NZXO#D|p+$// N PO L N^NuNVH0$n&n|/. / NrPO.|j7jHx/ N POJgJf/ NXO#D|`&p+ g/ NXOp+ASp// NPO L N^NuNVH0&n$n B+B+B+g/ / /.Nt `/ / /.N L N^NuNVH0&n$nv/+/+0gA `A  @NPOJgp`-k gp+ARpBkJJBgPp+g kB-H/ NXO n1@/+BNXOBBJkHg HkFNXO`/ NXO` HkJNXOp&_N^NuNVH0$nB`* "2S.mrnp` AXHHxHxRNdPO". n!&@GL A`pMC-IC"<ұ n!'ANB` "R7p@n A/0+MHH/NPOJgp`r kNJg kN fT/ NdXOJg/HyNPO`$/ NXO @d/HyNPO`p@0J+0f,<'`SJfR mpL N^NuNVH0(. D$hNG DC# DMB9 gHx/ / N p0*7@j 'j|Hx/ NPO|Hx/ NPO// NPOpL N^NuNVH0$n&np-@r2*cr2* er2* t4*҂tdp"#Dr `$p0*//*N,POJgp`/. / NPO.j 7jj 'jp0*7@|Hx/ NPOJgHx/ / N `Hx/ NPOJgHx/ / N `dHx/ NPOJgHx/ / Np `BHx/ NPOJgHx@/ / NN ` Hx/ NhPOJgHx / / N, |Hx/ NBPO// NPOpL N^NuNVH0&n $np*0//+N~PO7@$N/NXOp0+$gp@&r `߫Jfp@&r `R+p+c`B+R+++dp+AHp`B+R+B+&p`S+"p+"f`4Rk(k#4p @0rA&t `np0+$g`fp@'/ NXO kp1@BLp @4|r+/r/NXPO +`p+&/HyNPON>L N^NuNV y1n $ByHyN.XOpN^NuNVH0&n$|N#yHp+#/NXOp/NXOA#LL N^NuNVH0$n&||p @4BLr*/r/NPONjL N^NuNVp+*r++$// N PO`// N HPO*Hx/ NPOJg/ N XO#D~`/<p0+./N $$// N |PO`J A20H$`8 A20H$`&/ B// N.`/ /. /N\ . L N^NuNVH0G&. p0. -@r?®(AX$p C* "n,"¼g"t, [k nH0;Nl0j g`Hx/ /N Jgp`/ // Nh .mHx// Nd Jg~` g` Ep(g6 / / ./HyHNXp#Dr `pHx@~,Bp+0g(p+ g`p@@  o`<`p+0f(p+ g`p@@  o``ʼmp+ g`Hx@BNPO/BNPONv/NXO  l м'/ /NX `pLN^NuNVH0G<$|p*4.n 4 gBHxN.XO,A'H'K Hx/ NPO/ NXOJg B/ NPO/NXOL N^NuNVH0E/./././. . A@/0/.HyNB`& < g AdJg&p`Rpn g/ HyNPO`/. HyNPOHyNXOL N^NuNVN^NuN"N>/. / NdPO(.+gpxl~x ,%k5F%k 0g <` <@Hx/ NPO*߫ ݫJgjp0*/HxN ѫp0*/HxN z  p0* gp*rf +g`/ NLXO#Dv``8// NPO L N^NuNVH0$n&n/. / NhPO.j7jHx/ NPOJgHx/ / N `tHx/ NPOJgHx/ / N `R*gLHx/ NPOJgHx/ / Nb `*++f 0+kgp@Hx/ / N6 |Hx/ NLPO// N"POpL N^NuNVH0$n&n|/. / NPO.|Hx/ 4 jjL N^NuNVH0&np+ARp+$gdp0+"/p+!/p+ /p+ /p+$/+LHH/HyNB` 3Rp@np`p+gp+S@gS@gU@g@g S@g@fgET`EZ`E``Efp+/p+/p+/p0+/p+//+p+/p+// +LHH/HyN,p`p+gp+`p L N^NuNVH0$n &nHxNXO.RkHHkFNXOHx0HkNDPOjp@gp `p-@pgp@`p".A L N^NuNV/ &nSkHJkHg HkFXOpL N^NuNVH0*.&n( D$PAP&p-@ Er2t@e EJPfp"#Dr `HxNXO-@/. / N POJg`vB+ Eh E7hp ,pg6"A40k4+k e t+ kHkHk/ N^ B/ NPOJg` CgHx Ep0//N |p+r+Ё@p0+@p0+@.<`|SJf Ep0.`|p*,p*,p*, R @Pkk||p@/N(XOjp+qrQg/N nXOp@rAtB`SJftB`7n/ NnXOp#D/ N@"S-I gp` <8 n B AE`$%K p@  gp`p@Rp nRnB`& "*HA*HABAЁAhr1RpnpL N^NuNVH0p0. , AE&j &"C-Q" fr #Dt `// NPOJgp@/ N#ZXO`fN$H'@ k'hB+BkB+/ NXOJgp@/ N#XO`* np((p fV/ NBXOJgp@/ N"XO`/ NXOJgp@/ N"XO`Hxp+ /HkPN" `p@P .pg r+czp@Jg*pf"tA40*`"/p+r+Ё// N /+/ N NPO//N FPOJgp@`VJb``Rp+ c`DBR+++eB+RkHkHk/ N `S+p+f`B+ ARp`/NXOL N^NuNVH0&n. G$PBHxNbXO,JWDHH// NPOJg` npXp+Ю'@kJg&Hx/N POJgp@`r/+/ NPO`Np+/p0+/p+r+Ё// N/+/ NPOHx/N POJgp@`Jb`R`P/NXOL N^NuNV/ &np7@HkN*XOJkf&_N^NuNVH0&n$S.p Jgp` Dp(g$J+f/HyNRPOp#Dr `/ // N .mHx// N Jg~`H g`>Hx/ /N Jgp`0 Dp(g"JSf/HyNPOp#Dr `/ D/(// N.mHx// NH Jg~` g`/ // N .mHx// N Jg~` n .rC21 .A1~`X n .rC21 .A1~`0Jf`. n #~`/././/N. ` p"#Dr L N^NuNVH0&n$S.zHxN`XO, Ghp+gnNzPONzS++g ARpB+`p+W@g S@g0S@fbgFp+rfp@`p+ fp@`6p+rfp @`p @`p+rfp @`p@/ N XO kp1@"+ L N^NuNVH0&n.+ $S GjBkHkNXOpL N^NuNVH0&n$S.HxNjp+srQgNVH0BBGh`\$S gJf`Hp*g:z|/ kNXO,Jg"/N&XOJkg HkN&XO`/ N XOR*pnJfHyN&XON&pL N^NuNVH0(. gplp`A м/C@/ HxN&> Jgp`hBE` 5GR mB` n ,0"tlr `(HxHx.N%PO&@p@@ Hxr+ /HkN$ p@7@@ @gp`p@ gp`p"*HA*HABAЁAhC& POJg p@` F!j / // N< F'h F7h Fh Fh'j 9@  c *`  .'@p0/// N +/HxNl ߪ/HxN`.ߪ J+f` 7E/ NXO/ NXOpL N^NuNVH0$n&np .p+4pfr2+` RrA20 tA405Ap+ 5@5|pL N^NuNVH0&n, F$P(9p+.p0+&HxNXO*JWDHH// NPPOJg`Jkf+gsx`GkJg&//N POJg p@`/+/ N RPO`Lp+/p0+E,* p0. . < g SgSfXO,|||||p*f`j|p+wrQf@|p*t+@jjj .f`p@`(p+gp@p+ gp@S J fbp+fp@p+@fp@p+r@`n7|^p@7|y / N'xBHn/ N" p.@fp@/ NXXOJ+f`"7||p@`B+p @/ N*XO`\p0+Hx/N-Rp+/N-F%_p+r+ЁS/p+/N-* 7@Np gRjp`Np$#Dr L N^NuNVH0p0. AG$k p gSkJkgp`HyN,XOHyN,XOpL N^NuNVH0&np0+ AC* "E$i ,+"Ep)g20+Hf$p/HyN,*POp7@/ N+XO`j EdR/p*Hx/N,N, 7@/p*Hx/N+N+HxN+ /N  f`6nc" /p0+/Hy@N2 ` D0STTJfFp`p0+/HyrNPOpL N^NuNVH0(. &n S-PA-Hp+ -@"n/HxN2"AA/HxN$( ."Ҁ o`ZHx/NPOJgp@/ NXXO`8/+/.N(PO Ы$@ T.-n`p0-@ Gr2¼*+gr2t , Gr2&`p0r , Gp0&p0 f`p0fT Gp0fFp+cp+fp@p+@fp@p+rfp@~``P/NXO L N^NuNVH0$nphЪ&@p0+r+//N-_A*A&> T @0 p@| ` E0STJf|p` Cp SXJf +Sfl +-WDf +MWDJgRp0gLp@/HxN+ @0+je0*kB`Vp0+"Rt2"Tv2ԃf2+2xf( Zr2 Xt2҂7A Vr`Pp2x g mp0+WDg p+WDJfp+A<pHxN*XO(A.// HyN* JfJyfp3/N*BN2XO/N*XO`p7@/ N*XOpL N^NuNVH0&np-@r2. ¼AC. "G$i "<® gYg>SgHSgPfgP/ N.N(XO&Jgp`p#Dr `p0*&p`p0*&p`|p*&p`p*HgS@gW@g&@g@f g p&`p&0+/HyNr`* np0r"Gt4 XXSXJfp`p0+/HyN,POB+ pL N^NuNVH0$n&n */HxN.5|/p+ /Nr @/p+ /Nd./p+/NN @/p+/N@.p g". tA40ނp0+ bp+ ހ5GHjHj/ N L N^NuNVH0$n*. G n>*g Epr @` Epr @p* ,`DSd`BSf4T np00*g Ep0r ` Ep0r ` TSTJfL N^NuNVH0&n&. EBxB`B2xRp@n KRB~`0 .܀nB`p2XH0&n$n 0+ j f +`0+ H2* HL N^NuNVH0x .gPSgXSf &yB` Dp(rf`R  mp@rA/ N"XO kp1@/+N%XO`&yB` Dp( rf`6R  mp@rA/ N"jXO kp1@/+N$XO`BHn/ N Jg$p@/ N"0XO kp1@/+N$|XO`jp.f*p @rA/ N!XO kp1@/+N$DXO`2/ NXOJg kp1@/ N!.N$XO` /+N$XOJfHyN#XO$@JfHyN$XO`p0* AC* "E&i #'J7j jjHnWDgp{Ы @p WDgp|Ы @prCWDgp~Ы @pr-WDg <Ы @p WDg <Ы @p WDg <Ы @p WDg <Ы @p WDJf*p @rA/ N,pXO` kp(}r8f kp(t2fp@*plЫ @prmҫ Ar¼7@ppЫ @PpoЫ @PpxЫ @pryҫ Ar¼7@p@/ NXOJgp@/ N+XOHyN..XO`*B` +XмЇ @xR m`+Hg0S@gxW@g@g@fv7|,p@`|7|pr2* A j-Hpfr` R" nAj|pb@rAtB *g *fpP@rA` pP@B+|jj|||p0* dB`pp @B+Jg+`+p@ rA tp@RBRB++r+¼f` TpnNd/.NXO Dp`&Sp@Rj`Np0+ r2$҂b` +1fp`p@G p0r* Ё5@kk 5k p0+rpd`p0+"A p0+-@r2+(r+>g"t+d~ /p* /HjN /./ / NT ,// NFPO `4p0*/HyN"POp5@@rA B* 5@ @t L N^NuNVH0*.&n S& n =P C/HxN@ @@/HxN2* м@ o`Hx/NPOJgp@/ NhXO`p/+`p&`p&`p&`Bp`./ < /p0. AHpN)\ L N^NuNVH0G&. $np0. AC( "D*) , g "¼, [k nH0;Nn~BZr g`Hx/ /N( Jgp`|N/ /NTPO.NpJmHx// N(l .`> g`4 Dp(g*p0. /HyPN(hPOp#Dr `Hx / /N( Jgp`N8/ /NPO.N` g`Hx/ /N' Jgp` Dp(g0J+f*p0. /HyPNfR`RnHRRRnL N^NuNVH0&n$n 0+ j f +`0+ H2* HL N^NuNVH&np0+. ARpr+/r+/r+/r+/r2+/r+//+r2+/r+A /0Hy*N(LN^NuNVN^NuN N 2NTN>NN ZN TNurNuNN$NbNN,N |NN NXN NNgdNNNvN"NNVH0p&@ByBB||B+|||r+¼@g|p@r+¼@f|A H#BC/ NPOJg" kp1@rA/ N!".N#|XO`jJ+g +f|`|Jf-F`//.NPOL N^NuNV/ &n k0(Hg6/ N XOJf"Hx kHh k/(N" p`p@`xHx k/( kHhN" / NjXOJfJ+g@/ N XOJf$Hx kHh k/(N Jfp`p@rA ` p`p@&_N^NuNV/ GA'H'n /./ N""PO&_N^NuNVH0&n $np-@r2+t4*p0*Ԁcp0+r*bp"#Dr `5k k/ NXOJgp@@jr`^+gNB*HxN!XO.N!x/ N XO5 k / NXOJgp@@jr`p0+rfJ+fk `+gH/ N.XOJgp@@jr `Hx jHh/N R*`HHx/ jHhN / N XOJgp@@jrt `"R*SJf`B`BHxNXO-@Nj|/ NzXOJg(p@@jrNF/.NXOp` jp(Ar0*B`n Ѕro Ѕ` Ѕ-@Anp/ NXOJgjv*c*Hx jHhp*"Ҁ/N RpnN/.NXOBJgp@@rpL N^NuNVXOJgp`N7| 7| `NSk / NXOJgp`,BHn/ N Jgp`p.rfBk Bk p`p0+ bp@r `B+B+|Bk Bp7@ r7A `/ NXOJgp`HxN XO,N / NXOJg p+rf8 kp( kr(¼7@ N p/N XO`N `/N XOXk RpnxBp 7@ r7A `/ NXOJgp` HxN \XO,N |/ N"XOJg p+rf6 kp( kr(¼7@ N /N XO`NN /N XOYk Rpnt7| / NXOJgp`xp7@ / NXOJgp`dBk Bk p`XDr `R SRpc`BR+d`BRCkd`p#Dr `RE7C 0+ ke0+k / N~XOJgp@/ NXOp#Dr `JRg`j`bBpL N^NuNVH0&n $np*6p0*r2*Ё7@p7@7|r L N^NuNVH&nB`Vp0+ "Rt3"Tv3ԃf2+3xf( Zr3 Xt3҂7A Vs`Pp3x g m/ N*XOLN^NuNVpN^NuNVH0$np&@r*&B*.* /p+Hx/N\N^ 7@ 60+ ke0+k /p+Hx/N,NHxN& @/HxN @/ NXOJgp@/ N`XOp#Dr `p+.pbr+fJRgJk f+gB.|HxN|XO-@N0|/ N@XOJg,N /.N`XOp@/ NXOp#Dr `$ kp(Ar0-AB` Юro Ю` Юސ-@Ap/ NXOJgp+cp+,kHx kHhpBk / NXOJgp`FHxN XO,N N/ NdXOJfN D/N XOp`N 4/N vXOp` p @r L N^NuNVH0$np&@r.¼AB`p+g`R mp@r `J+B`Rp(nB`p+f`R mp@+r `+pL N^NuNVH0$np&@r.A¼AB`p+g`R mp@r `T+B`R mB`p+f`R mp@+r ` n +pL N^NuNVH0*. &np$@r-A+HgSBg`WBgpBghBfgp0+ r2+ . EBXONj/ NXOJgN`/NXO`\j|pb@rAtB *g *fpP@rA` pP@B+|jj|||Bp @B+rA j tp@RBRkrA+N/NXO.HHg8p@r* tcR* `RjSp@ *wfrA `.* G*f@p0* Gr(f(p0* Gr(f G*(f Ep`p@RjS`x EpL N^NuNVH0$np&@x r-AB~ *wf~Joj|pb@rAB+ *g *fpP@rA` pP@B+|ppp0+ B // N Jgp`0+ k fp`Hxp0+ // N Jgp`7k B`L Fp(rg`:BHn/ Nn Jgp`p.rfp`p @r `|R PmS`p@r `^p+r+¼ r¼pB // N Jgp`0+ k f`0+ k c6HxHx/ N Jgp`Rk 0+ k f` HxXN|XO`0+ k d6HxHx/ N Jgp`Sk 0+ k f` HxXNl`RpnpG@rAt+ļp+ ppp0+ B // N Jgp`BHn/ N Jgp`0+ k fpG@rA EBt `tHxp0+ // N6 Jgp`T7k p`Hp+r+¼ r¼pB // N Jgp`0+ k fpG@ rA EB`0+ k c8HxHx/ N Jgp`Rk 0+ k f` HxXNXO`0+ k d8Hxjj|||p0* dB`pBp @B+rA G tp@RBR+rA+$HHļg$tBpoR`$S~ *wf~`,*p* fp` F*f`p0* Fr(fHp0* Fr(f4p* Fr(npG@ E p+ rg`p`p@SJg`|pL N^NuNVH0$np&@r -AvB,PO&@ fp`BHx/</ N( HxHy м@/N м@P. GNpL N^NuNVH0E|zp0. mp #Dr ` yp0. GJkgp&#Dr `//N`PO.Jfp`HxHx//BNFHxHx//N8/< r '@ /N$POHx@Hy k /N HxHy\ k /N k + rHx Hy\ k / table)Illegal system callFile too bigToo many devices mountedNot a directory:Directory file:Privileged system callNot mountable device:File system busy:Not ordinary file:Device not mounted:No processes to wait forAll memory in useDivide overflowNo system buffers availableArg list too bigToo many links:Illegal link:No device driver:No process tables availableBad valueNot connectedDevice open errorDirectory in use:File in use:No match:Channel access errorNot a Cromix diskp0+ $p0+"Ҁ// p+ /NH .7j `p0+ $p0+"Ҁ// p+ /N .7j `/ p+ /NPO.Jg`j`p+/p+ /NPO.`/ p+ /p+ /N .Jl` Sg SgUfgj B`7j B`'R B` p"#D~`H k c p"#D~`4=k=k -k0+ gHn/NPO` Hn/NpPO.Jl 9D@p@ `B+ BSNp0f NJgpL N^NuNVH0&n n$h p0.`p2xfp0"R7Ap`R mp"#Dr L N^NuNVH0&n n$h p0.`(p2xErrorIllegal InstructionZero DivideCHK InstructionTRAPV instructionPrivilege ViolationTraceLine 1010 EmulatorLine 1111 EmulatorFormat ErrorUninitialized InterruptSpurious InterruptLevel 1 Interrupt AutovectorLevel 2 Interrupt AutovectorLevel 3 Interrupt AutovectorLevel 4 Interrupt AutovectorLevel 5 Interrupt AutovectorLevel 6 Interrupt AutovectorLevel 7 Interrupt AutovectorTrap 0Trap 1Trap 2Trap 3Trap 4Trap 5Trap 6Trap 7Trap 8Trap 9Trap 1C!"!"}s1*^#V#"^S#"Ss1> s1>&o"*^#V#"Ss1!">^>G1{*Nucromix... 6Jp,Bj*>Rl~ggggggggggggggggggggggggggggggggggggggggggggggggggggggggggg Unexpected interrupt vector %02lxH Address: Memory test by 16K blocks %06lxh: %lc Need good RAM from %08lxH to %08lxH Setpage: %ld /etc/shell.bin~xsnie`\XTPMJFC@=;8631/-+)'&$"! usrbufN RkpL N^NuNVH| yp0. G < r .HxHx//BNbBHx//NVB SkpLN^NuNV/ &np(7@/ NXOp&_N^NuNV/ &n . f &p` p"#Dr &_N^NuNVH0G$n yp0. C, . Sk2 n(H0;N 6`Hx/ /Nx Jgp`/ /NPO.`Hx/ /NN Jgp`/ /NRPO.`Hx/ /N$ Jgp`/ /NPO.mHx// N Jg~`Hx/ /N Jgp`p/ /NPO.mHx// N Jg~`HHx/ /NBad free listBad inode numberRead only file systemProcess not foundAborted system callPipe errorKey lockedDeadlockLock table exhaustedTape I/O errorI/O errorCannot run Z80 programsBad file formatRunaway program abortedCDOS simulator requiredSystem image corruptedIPC access errorIPC insufficient spaceIPC facility already existsIPC facility not foundIPC facility removedIPC try againIPC facility too bigIPC no message waitingIPC range errorOut of page tablesOut of shared g p2xr fp0"R7Ap`R mp"#Dr L N^NuNVN^NuN |N NNhNN N7N8|N6N7DN:NNNuNurN$NbNNplNsNpN NNN N H@A0/ H@ /@@HHJg?Hz ? @ PNNu "%(+.147:=@CFILORUX[^adgjmpsvy|0Trap 11Trap 12Trap 13Trap 14Trap 15WriteRead System shutdown in progress System shutdown complete Cannot boot Cromix-Plus Unimplemented function at address %06.6lx Not a Cromix-Plus disk %s %s Cannot start process One Floppy = 1, STDC = 6 Enter major root device number: fda = 0, fdb = 1, fdc = 2, fdd = 3 sfda = 4, sfdb = 5, sfdc = 6, sfdd = 7 dfda = 16, dfdb = 17, dfdc = 18, dfdd = 19 Enter minor root 2DR\r(2JZr$:RbvUnknown error number%Bad channel numberToo many files open for this processChannel not openEnd of fileDisk I/O errorToo many files open for the systemFile not found:Illegal file name:Directory not accessible:File not accessible:File already exists:Disk space exhaustedDisk directory space exhausted (inodes)Too many files open (inodeinofilmntlckmsgshmsem ,( , ( ,  ($,Cannot find free map @(#)xmm.c 1.2 (2/5/87)4t6` Jgp`2/ /NPO.mHx// N Jg~` p"#D~ L N^NuNVH0&n n$h p0r2+Ё cp"#Dr `8p0+//+NPOJgp`p0+/p0Hr/+N2 pL N^NuNVH0&n n$h p0r2+Ё cp"#Dr `8p0+//+NPOJgp`p0+//+p0HrN pL N^NuNVH0&n (.E D,( F&HxNXO*Hx/ F/N JyXgN CNJyXgNHx F// N p0f/p0+/NPO`/NXOp0rf0+@gU@gS@gHS@gvS@g@fpgtext tablesBad addressLSystem %s: Base address %08lx Programflr| 8:<>@BDFH\z.6>FNV^fnv~ %s aborted: %s at location %06lx, status register %04lx Data Cycle Fault Address: %06lx, %s error  System Crash @(#)except.c 1.3 (2/5/87)ResetResetBus ErrorAddress  !$'*-03661Q68010 XPU 151 Cromix-Plus Operating System Copyright (c) 1986 Cromemco, Inc.  0 0Inrdblk error, Dev %ld:%ld, Inode %ld Mtgetfs error ggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggg6 P 0Boot System(<hD@(#)sysdev.c 1.1 (1/23/87)6n P`p@(#)fdctim.c 1.1 (1/23/87)X$8 (*P8:`hjpxz./dev 7463 77777 77777 0 4016377343 5175 1%s %s error, Unit %ld, Side %ld, Track %ld, Sector %ld, %sStatus %04lx @(#)flop.c 1.1 (1/23/87)SelectHomeRead addressSeekPrereadReadWriteWrite trackNot ReadyNot FoundCRC ErrorLost Datah STDC%ld Interrupt without done -@-T-j- Incorrect version of STDC%ld firmware (1.20 or later required) STDC%ld handshake error STDC%ld Drive %ld Unit %ld write protected STDC%ld Drive %ld Unit %ld write protected STDC%ld not ./dev/fdb 7400 77777 77777 0 4016377345 6350 3 401                    Rdsec started with no lock set Wrsec started with no lock set $Q#BA .4<BHHD %s error, Unit %ld, Head %ld, Cyl %ld, Sector %ld, Status %02lx TVh~ Status decode: %s @(#)hd.c 1.1 (1/23/87)selecthomeread addressseekprereadreadwritewrite trackNo Ack from DriveBusy (Ack) from DriveTimeou./dev/sfda 7400 77777 77777 0 4016377347 6537 3 404Uart driver: Missing arguments Uart driver: Bad argument: %ld Uart driver: Not supported: %ld Uart driver: Cannot install: %ld @(#)utty.c 1.4 (2/14/87)p*XX Cannot overwrite the Kernel @(#)memdev.c 1.1 (1/23/87)./dev/root 7400 77777 77777 0 4016377344 6532 3 0interrupting STDC%ld error on flushing %ld write buffers. Drive %ld, Unit %ld, Head %ld, Cylinder %ld STDC%ld %s Error: Drive %ld, Unit %ld, Block %ld, Head %ld, Cyl %ld, Stat %02lx,Error %02lx%02lx ReadWriteOpen@(#)stdc.c 1.3 (12/11/86).012r3\4 Unexpected SMD interrupt SMD Unit %ld write protected SMD Unit %ld write protected Invalid state %ld SMD Unit %ld not properly initialized SMD Unit %ld, Invalid partition table entry %ld SMD Unit %ld, Cann./dev/fdc 7400 77777 77777 0 4016377346 6353 3 402tFault ErrorCRC ErrorHeader did not CompareHeader Compare Failed after SeekWrite Data did not VerifyNon-Supported Drive TypeBad Label FormatNo Unit Ready from DriveklpqHs,tPX@(#)tuart.c 1.1 (1/23/87)x@(#)blkutl.c 1.1 (1/23/87)>Nu<./dev/sfdb 7400 77777 77777 0 4016377347 6541 3 405 " H                    M0Mp( (` M0Mp( (` ݂ CFLOP unit %ld: No index pulses CFLOP unit %ld: Wrong size drive selected CFLOP Unit %ld write protected CFLOP Unit %ld write protected CFLOP invalid state %ld CFLOP@(#)cflop.c 1.1 (1/23/87) , Dv"  &2<FP./dev/fda 7400 77777 77777 0 4016377345 6346 3 400ot read partition table SMD Unit %ld, Invalid alternate track entry %04lx %04lx SMD Unit %ld, Cannot read alternate track table SMD %s error: Unit %ld, Block %ld, Head %ld, Cyl %ld, Sect %ld, Stat %02lx, Error %02lx%02lx @(#)smd.c 1.1 (1/23/87)selecthomeseekreadwriteselect headprereadDFHHIJCannot read alternate track table. HD Unit %ld write protected      HD Unit %ld write protected       ./dev/fdd 7400 77777 77777 0 4016377346 6355 3 4036 ./dev/sfdc 7400 77777 77777 0 4016377350 6535 3 406./dev/ftcd 7400 77777 77777 0 4016377355 6557 3 2004./dev/dfdb 7400 77777 77777 0 4016377352 6514 3 421./dev/sftab 7400 77777 77777 0 4016377356 6737 3 2040./dev/amem 7400 77777 77777 0 4016377353 6553 3 1400./dev/sftp1 7400 77777 77777 0 4016377360 6676 3 2064./dev/sfdd 7400 77777 77777 0 4016377351 6540 3 407./dev/ftp0 7400 77777 77777 0 4016377355 6506 3 2020./dev/dfdc 7400 77777 77777 0 4016377352 6516 3 422./dev/sftcd 7400 77777 77777 0 4016377357 6750 3 2044./dev/ftab 7400 77777 77777 0 4016377354 6546 3 2000./dev/rd0 7400 77777 77777 0 4016377361 6321 3 2400./dev/dfda 7400 77777 77777 0 4016377351 6511 3 420./dev/ftp1 7400 77777 77777 0 4016377356 6514 3 2024./dev/dfdd 7400 77777 77777 0 4016377353 6521 3 423./dev/sftp0 7400 77777 77777 0 4016377360 6671 3 20607 ./dev/rd1 7400 77777 77777 0 4016377361 6323 3 2401./dev/std32 7400 77777 77777 0 4016377366 6601 3 3040./dev/std0 7400 77777 77777 0 4016377363 6505 3 3000./dev/std35 7400 77777 77777 0 4016377367 6610 3 3043./dev/std3 7400 77777 77777 0 4016377365 6515 3 3003./dev/sd0r31 7400 77777 77777 0 4016377371 6664 3 3437./dev/rd2 7400 77777 77777 0 4016377362 6326 3 2402./dev/std33 7400 77777 77777 0 4016377366 6603 3 3041./dev/std1 7400 77777 77777 0 4016377363 6507 3 3001./dev/std63 7400 77777 77777 0 4016377371 6613 3 3077./dev/std31 7400 77777 77777 0 4016377365 6605 3 3037./dev/sd0f0 7400 77777 77777 0 4016377372 6557 3 3440./dev/rd3 7400 77777 77777 0 4016377362 6330 3 2403./dev/std34 7400 77777 77777 0 4016377367 6606 3 3042./dev/std2 7400 77777 77777 0 4016377364 6512 3 3002./dev/sd0r0 7400 77777 77777 0 4016377371 6566 3 34007 ./dev/sd0f31 7400 77777 77777 0 4016377372 6655 3 3477./dev/sd2f31 7400 77777 77777 0 4016377377 6666 3 3677./dev/sd1f0 7400 77777 77777 0 4016377374 6563 3 3540./dev/sd3f0 7400 77777 77777 0 4016377401 6556 3 3740./dev/sd2r31 7400 77777 77777 0 4016377376 6675 3 3637./dev/hd1 7400 77777 77777 0 4016377403 6304 3 4001./dev/sd1r0 7400 77777 77777 0 4016377373 6572 3 3500./dev/sd3r0 7400 77777 77777 0 4016377400 6565 3 3700./dev/sd1f31 7400 77777 77777 0 4016377375 6662 3 3577./dev/sd3f31 7400 77777 77777 0 4016377402 6655 3 3777./dev/sd2f0 7400 77777 77777 0 4016377377 6570 3 3640./dev/hd2 7400 77777 77777 0 4016377404 6307 3 4002./dev/sd1r31 7400 77777 77777 0 4016377374 6671 3 3537./dev/sd3r31 7400 77777 77777 0 4016377401 6664 3 3737./dev/sd2r0 7400 77777 77777 0 4016377375 6576 3 3600./dev/hd0 7400 77777 77777 0 4016377402 6301 3 40008 ./dev/hd3 7400 77777 77777 0 4016377404 6311 3 4003./dev/tty7 7714 77777 77777 0 4016377411 6526 2 411./dev/tty2 7714 77777 77777 0 4016377406 6525 2 402./dev/qtty1 7714 77777 77777 0 4016377413 6716 2 1000./dev/tty5 7714 77777 77777 0 4016377410 6530 2 407./dev/qtty4 7714 77777 77777 0 4016377414 6725 2 1003./dev/tty 7777 77777 77777 0 4016377405 6405 2 0./dev/tty8 7714 77777 77777 0 4016377412 6531 2 412./dev/tty3 7714 77777 77777 0 4016377407 6532 2 405./dev/qtty2 7714 77777 77777 0 4016377413 6720 2 1001./dev/tty6 7714 77777 77777 0 4016377410 6523 2 410./dev/qtty5 7714 77777 77777 0 4016377415 6730 2 1004./dev/tty1 7714 77777 77777 0 4016377406 6522 2 400./dev/tty9 7714 77777 77777 0 4016377412 6533 2 413./dev/tty4 7714 77777 77777 0 4016377407 6534 2 406./dev/qtty3 7714 77777 77777 0 4016377414 6723 2 10028 ./dev/qtty6 7714 77777 77777 0 4016377415 6732 2 1005./dev/mtty6 7714 77777 77777 0 4016377422 6726 2 1205./dev/mtty1 7714 77777 77777 0 4016377417 6720 2 1200./dev/null 7777 77777 77777 0 4016377424 6625 2 1400./dev/mtty4 7714 77777 77777 0 4016377421 6721 2 1203./dev/lpt2 7735 77777 77777 0 4016377426 6533 2 2402./dev/qtty7 7714 77777 77777 0 4016377416 6735 2 1006./dev/mtty7 7714 77777 77777 0 4016377422 6730 2 1206./dev/mtty2 7714 77777 77777 0 4016377420 6714 2 1201./dev/timer 7421 77777 77777 0 4016377424 6752 2 2000./dev/mtty5 7714 77777 77777 0 4016377421 6723 2 1204./dev/lpt3 7735 77777 77777 0 4016377426 6540 2 2406./dev/qtty8 7714 77777 77777 0 4016377416 6737 2 1007./dev/mtty8 7714 77777 77777 0 4016377423 6733 2 1207./dev/mtty3 7714 77777 77777 0 4016377420 6716 2 1202./dev/lpt1 7735 77777 77777 0 4016377425 6534 2 24059 ./dev/lpt4 7735 77777 77777 0 4016377427 6543 2 2407./dev/slpt6 7735 77777 77777 0 4016377434 6721 2 3410./dev/slpt1 7735 77777 77777 0 4016377431 6710 2 3400./dev/slpt9 7735 77777 77777 0 4016377436 6731 2 3413./dev/slpt4 7735 77777 77777 0 4016377432 6722 2 3406./dev/qslpt3 7735 77777 77777 0 4016377437 7104 2 4402./dev/typ1 7735 77777 77777 0 4016377430 6542 2 3005./dev/slpt7 7735 77777 77777 0 4016377434 6723 2 3411./dev/slpt2 7735 77777 77777 0 4016377431 6713 2 3402./dev/qslpt1 7735 77777 77777 0 4016377436 7077 2 4400./dev/slpt5 7735 77777 77777 0 4016377433 6725 2 3407./dev/qslpt4 7735 77777 77777 0 4016377440 7100 2 4403./dev/typ2 7735 77777 77777 0 4016377430 6540 2 3002./dev/slpt8 7735 77777 77777 0 4016377435 6726 2 3412./dev/slpt3 7735 77777 77777 0 4016377432 6720 2 3405./dev/qslpt2 7735 77777 77777 0 4016377437 7102 2 44019 ./dev/ffp 7421 77777 77777 0 4016377441 6407 2 5000./dev/z80/zio2 7442 77777 77777 0 4016377445 7154 3 4401./dev/tp2 7400 77777 77777 0 4016377443 6345 2 5401./dev/z80/xpu1 7442 77777 77777 0 4016377447 7164 3 5000./dev/z80 7421 77777 77777 0 4016377444 5612 1./dev/z80/xpu4 7442 77777 77777 0 4016377451 7165 3 5003./dev/max 7421 77777 77777 0 4016377441 6422 2 5001./dev/z80/zio3 7442 77777 77777 0 4016377446 7157 3 4402./dev/tp3 7400 77777 77777 0 4016377443 6347 2 5402./dev/z80/xpu2 7442 77777 77777 0 4016377450 7160 3 5001./dev/z80/zio1 7442 77777 77777 0 4016377445 7152 3 4400./dev/z80/xpu5 7442 77777 77777 0 4016377452 7170 3 5004./dev/tp1 7400 77777 77777 0 4016377442 6342 2 5400./dev/z80/zio4 7442 77777 77777 0 4016377447 7162 3 4403./dev/tp4 7400 77777 77777 0 4016377444 6352 2 5403./dev/z80/xpu3 7442 77777 77777 0 4016377451 7163 3 5002: ./dev/z80/xpu6 7442 77777 77777 0 4016377452 7172 3 5005tialize track BMD_PRDWRT equ 7 ; Primitive read/write BMD_RDWRT equ 8 ; Special read/write BMD_RPM equ 9 ; Get RPM BMD_VERSION equ 10 ; Version number BMD_PHYCHAR equ 11 ; Physical characteristics BMD_LDFIRM equ 12 ; Load firmware BMD_SOFT equ 13 ; Accumulated number of retries BMD_HARD equ 14 ; Accumulated number of hard errors BMD_RETRY equ 15 ; Number of retries before h./dev/console 7714 77777 77777 0 4016377406 11101 1./dev/tty12 400 ; XMM usage ; D3-register & D4-register bits for BMD_STATUS calls ; DS_BUSY equ 0 ; Device Busy (in use) DS_WANT equ 1 ; Device Wanted (do wakeup) DS_READ equ 2 ; Read-only device DS_MODF equ 3 ; Super-block modified DS_MOUNT equ 4 ; Device mounted DS_HOME equ 5 ; Device has been homed DS_BFSTEP equ 6 ; Buffered step flag DS_VERIFY equ 7 ; Verify after write ; D./equ/bmodeequ.asm 7421 77777 77777 17600 4026366704 7700 0 D3-register & D4-register bits for BMD_FLG3 calls ; D3_WRTPRO equ 0 ; Device is write protected D3_INTRPT equ 1 ; Device interrupts D3_DUAL equ 2 ; Dual drive ; Floppy minor device number bits ; FDENSITY equ 6 ; 0 = double density FSIDES equ 5 ; 0 = double sided FDUAL equ 4 ; 1 = dual drive (PERSCI) FDTRACK equ 3 ; 1 = double tracked FSIZE equ 2 ; 0 = 8", 1 = 5" F./dev/z80/xpu7 7442 77777 77777 0 4016377453 7175 3 5006ard error ; ; Values 16 .. 63 reserved ; Values 64 .. 127 special device modes ; Values 128 .. 255 reserved for user ; supplied drivers ; Floppy tape special numbers ; BMD_RETEN equ 64 ; Number of tape repositions before ; a retension ; IMI disk special numbers ; BMD_IMITYPE equ 64 ; Get type of IMI drive ; Values returned by BMD_IMITYPE ; IM_50070 equ 01H ; IMI model 50070 IM_5007W equ 02H ; IMI model 5007W IM_5018./drive 7463 0 0 0 3727147314 5222 03-register & D4-register bits for BMD_FLG1 calls ; DF_SMALL equ 0 ; 1=small floppy 0=large floppy DF_DSIDE equ 1 ; Double sided DF_DDENS equ 2 ; Double density DF_DTRACK equ 3 ; Double tracked DF_CROMIX equ 4 ; Cromix format disk DF_CDOS equ 5 ; Cdos format disk DF_BACKUP equ 6 ; Backup format disk DF_VOICE equ 7 ; 0=step 1=voice coil ; D3-register values for BMD_FLG2 calls  list off, noxref ; ; Cromemco Inc. ; Feb 12, 1986 ; ; Mode definitions for block devices ; ; D2-register values for _GETMODE and _SETMODE system calls ; BMD_STATUS equ 0 ; Get/set status byte BMD_FLG1 equ 1 ; Get/set flag1 byte BMD_FLG2 equ 2 ; Get/set flag2 byte BMD_FLG3 equ 3 ; Get/set flag3 byte BMD_SIZE equ 4 ; Get number of bytes on device BMD_SEEK equ 5 ; Seek BMD_INIT equ 6 ; IniUNIT equ 03H ; Mask for unit number ; SMD minor device number bits ; CONTROLLER equ 7 ; Controller number DRIVE equ 6 ; Drive number FIXED equ 5 ; Fixed flag PARTITION equ 1FH ; Partition number mask ; Data structure for BMD_INIT call ; struct 0 in_flags ds.w 1 ; Density from minor device number in_side ds.w 1 ; Side to initialize in_track ds.w 1 ; Track to initialize ./dev/z80/xpu8 7442 77777 77777 0 4016377453 7177 3 5007H equ 03H ; IMI model 5018H IM_7710A equ 04H ; IMI model 7710A IM_7710B equ 05H ; IMI model 7710B ; Memory driver special numbers ; BMD_TMEM equ 64 ; Total memory BMD_SMEM equ 65 ; System memory BMD_HMEM equ 66 ; Shared memory BMD_FMEM equ 67 ; Free memory BMD_MMEM equ 68 ; Maximal free memory BMD_CACR equ 69 ; CACR register ; Reserved BMD_XMM equ 71./equ 7463 77777 77777 0 4016377455 5215 1; D2_SMALL equ 0 ; Small floppy D2_LARGE equ 1 ; Large floppy D2_STDC equ 2 ; STDC hard disk D2_FSMD equ 3 ; Fixed part of SMD hard disk D2_RSMD equ 4 ; Removable part of SMD hard disk D2_UNIFORM equ 5 ; Uniform floppy D2_MEMORY equ 6 ; Processor memory D2_RAM equ 7 ; RAM disk D2_FTAPE equ 8 ; Floppy tape D2_IMI equ 9 ; IMI hard disk ;: in_buf ds.l 1 ; Pointer to track image in_size ds 0 ; Size of structure mend ; Data structure for BMD_SEEK call ; struct 0 sk_status ds.b 1 ; Return status sk_ferror ds.b 1 ; Fatal error number sk_serror ds.b 1 ; System error number sk_verify ds.b 1 ; Verify seek flag sk_side ds.w 1 ; Side sk_track ds.w 1 ; Track sk_size ds 0 ; Size of structure mend ; Da/* Mode definitions for block devices Cromemco Inc. Feb 12, 1986 */ /* Mode numbers for getmode and setmode calls */ #define BMD_STATUS 0 /* Get/set status byte */ #define BMD_FLG1 1 /* Get/set flag1 byte */ #define BMD_FLG2 2 /* Get/set flag2 byte */ #define BMD_FLG3 3 /* Get/set flag3 byte */ #define BMD_SIZE 4 /* Get number of bytes on device */ #define BMD equ 1 ; Not IO error sts_select equ 2 ; Error on select sts_seek equ 3 ; Error on seek sts_prd equ 4 ; Error on primitive read sts_pwr equ 5 ; Error on primitive write sts_ptx equ 6 ; Error on transfer ; ; Floppy ; fls_select equ 1 ; Error on select fls_home equ 2 ; Error on home fls_rdadd equ 3 ; Error on read address fls_seek equ 4 ; Error on ecial numbers */ #define BMD_RETEN 64 /* Number of tape repositions before */ /* a retension */ /* IMI disk special numbers */ #define BMD_IMITYPE 64 /* Get type of IMI drive */ /* Values returned by BMD_IMITYPE */ #define IM_50070 0x01 /* IMI Model 50070 */ #define IM_5007W 0x02 /* IMI Model 5007W */ #define IM_5018H 0x03 /* IMI Model 5018H * ds.w 1 ; Flags (see bellow) ldf_count ds.w 1 ; Number of bytes ldf_buf ds.l 1 ; Pointer to firmware ldf_size ds 0 ; Size of structure mend LDFRM_DEBUG equ 8DH ; Load debugger firmware LDFRM_FIRM equ 8FH ; Load regular firmware list xref, on  */ #define DS_MODF 0x08 /* Super-block modified */ #define DS_MOUNT 0x10 /* Device mounted */ #define DS_HOME 0x20 /* Device has been homed */ #define DS_BFSTEP 0x40 /* Buffered step flag */ #define DS_VERIFY 0x80 /* Verify after write */ /* Mode values and masks for BMD_FLG1 calls */ #define DF_SMALL 0x01 /* 1=small floppy 0=large floppy ta structure for BMD_RDWRT call ; struct 0 rw_read ds.w 1 ; Read/write flag rw_buf ds.l 1 ; Buffer pointer rw_number ds.l 1 ; Number of blocks rw_blknr ds.l 1 ; Starting block number rw_size ds 0 ; Size of structure mend ; Data structure for BMD_PRDWRT call ; struct 0 prw_status ds.b 1 ; Controller status prw_ferror ds.b 1 ; Fatal error number prw_serror ds.b 1 ; System error _SEEK 5 /* Seek */ #define BMD_INIT 6 /* Initialize track */ #define BMD_PRDWRT 7 /* Primitive read/write */ #define BMD_RDWRT 8 /* Special read/write */ #define BMD_RPM 9 /* Get RPM */ #define BMD_VERSION 10 /* Version number */ #define BMD_PHYCHAR 11 /* Physical Characteristics *seek fls_pread equ 5 ; Error on preread fls_read equ 6 ; Error on read fls_write equ 7 ; Error on write fls_wtrk equ 8 ; Error on write track ; ; SMD ; sms_select equ 1 ; Error on select sms_home equ 2 ; Error on home sms_seek equ 3 ; Error on seek sms_read equ 4 ; Error on read sms_write equ 5 ; Error on write sms_head equ 6 ; Error on select h/ #define IM_7710A 0x04 /* IMI Model 7710A */ #define IM_7710B 0x05 /* IMI Model 7710B */ /* Memory driver special numbers */ #define BMD_TMEM 64 /* Total memory */ #define BMD_SMEM 65 /* System memory */ #define BMD_HMEM 66 /* Shared memory */ #define BMD_FMEM 67 /* Free memory */ #define BMD_MMEM ./equ/bmodeequ.h 7421 77777 77777 24501 4026366723 7346 0 */ #define DF_DSIDE 0x02 /* Double sided */ #define DF_DDENS 0x04 /* Double density */ #define DF_DTRACK 0x08 /* Double tracked */ #define DF_CROMIX 0x10 /* Cromix format disk */ #define DF_CDOS 0x20 /* Cdos format disk */ #define DF_BACKUP 0x40 /* Backup format disk */ #define DF_VOICE 0x80 /* 0=step 1=voice coilnumber prw_read ds.b 1 ; Read write flag prw_buf ds.l 1 ; Buffer pointer prw_number ds.w 1 ; Number of sectors to do prw_sector ds.w 1 ; Starting sector number prw_surface ds.w 1 ; Surface number to read/write prw_cylinder ds.w 1 ; Cylinder number to read/write prw_size ds 0 ; Size of structure mend ; Status bits for primitive operations ; ; STDC ; sts_ioerror equ 0 ; IO error sts_nioerror/ #define BMD_LDFIRM 12 /* Load firmware */ #define BMD_SOFT 13 /* Accumulated number of retries */ #define BMD_HARD 14 /* Accumulated number of hard errors */ #define BMD_RETRY 15 /* Number of retries before hard error */ /* Values 16 .. 63 reserved */ /* Values 64 .. 127 special device modes*/ /* Values 128 .. 255 reserved for user */ /* supplied drivers */ /* Floppy tape spead sms_pread equ 7 ; Error on preread ; Data structure for BMD_PHYCHAR call ; struct 0 phy_surface ds.w 1 ; Number of surfaces on device phy_cylinder ds.w 1 ; Number of cylinders on device phy_sector ds.w 1 ; Number of sectors/track phy_secsiz ds.w 1 ; Number of bytes/sector phy_size ds 0 ; Size of structure mend ; Data structure for BMD_LDFIRM call ; struct 0 ldf_flags  68 /* Maximal free memory */ #define BMD_CACR 69 /* CACR register */ /* Reserved */ #define BMD_XMM 71 /* XMM usage */ /* Mode values and masks for BMD_STATUS calls */ #define DS_BUSY 0x01 /* Device Busy (in use) */ #define DS_WANT 0x02 /* Device Wanted (do wakeup) */ #define DS_READ 0x04 /* Read-only device ;  */ /* Mode values for BMD_FLG2 calls */ #define D2_SMALL 0 /* Small floppy */ #define D2_LARGE 1 /* Large floppy */ #define D2_STDC 2 /* STDC Hard disk */ #define D2_FSMD 3 /* Fixed part of SMD hard disk */ #define D2_RSMD 4 /* Removable part of SMD hard disk */ #define D2_UNIFORM 5 /* Uniform floppy */ # /* Non I/O error */ #define STS_SELECT 0x04 /* Error on select */ #define STS_SEEK 0x08 /* Error on seek */ #define STS_PRD 0x10 /* Error on primitive read */ #define STS_PWR 0x20 /* Error on primitive write */ #define STS_PTX 0x40 /* Error on transfer */ /* Floppy */ #define FLS_SELECT 0x01 /* Error on select */ # /* 1=double tracked */ #define FSIZE 0x04 /* 0=8" 1=5" */ #define FUNIT 0x03 /* physical unit number mask */ /* SMD minor device number assignment */ #define CONTROLLER 0x80 /* Controller mask */ #define DRIVE 0x40 /* Drive number mask */ #define FIXED 0x20 /* Fixed flag mask */ #define PARTITION 0x1f /* Partition  /* Error on preread */ /* Data structure for BMD_PHYCHAR call */ typedef struct { unsigned short surface; /* number of surfaces on device */ unsigned short cylinder; /* number of cylinders on device*/ unsigned short sector; /* number of sectors/track */ unsigned short secsiz; /* number of bytes/sector */ } bm_phy; /* Data structure for BMD_LDFIRM call */ typedef struct { unsigned short flags; /* flags (see below)  */ unsigned long number; /* no. of blocks to read/write */ unsigned long blknr; /* starting block number */ } bm_rdwrt; /* Data structure for BMD_PRDWRT call */ typedef struct { unsigned char status; /* return status */ unsigned char ferror; /* fatal error number */ unsigned char serror; /* system error number */ unsigned char read; /* Read/write flag */ unsigned cha list off, noxref ; ; Cromemco Inc. ; May 30, 1986 ; ; Mode definitions for block devices ; ; C-register values for .GETMODE and .SETMODE system calls ; BMD_STATUS defv 0 ; Get/set status byte BMD_FLG1 defv 1 ; Get/set flag1 byte BMD_FLG2 defv 2 ; Get/set flag2 byte BMD_FLG3 defv 3 ; Get/set flag3 byte BMD_SIZE defv 4 ; Get number of bytes on device BMD_VERSION defv 10 define D2_MEMORY 6 /* Processor memory */ #define D2_RAM 7 /* RAM disk */ #define D2_FTAPE 8 /* Floppy tape */ #define D2_HD 9 /* WDI hard disk */ /* Values 10 .. 127 reserved */ /* Values 128 .. 255 reserved for user */ /* supplied drivers */ /* Mode values and masks for BMD_FLG3 calls */ #define D3_WRTPRO define FLS_HOME 0x02 /* Error on home */ #define FLS_RDADD 0x03 /* Error on read address */ #define FLS_SEEK 0x04 /* Error on seek */ #define FLS_PREAD 0x05 /* Error on preread */ #define FLS_READ 0x06 /* Error on read */ #define FLS_WRITE 0x07 /* Error on write */ #define FLS_WTRK 0x08 /* Error on write tracknumber */ /* Data structure for BMD_INIT call */ typedef struct { unsigned short flags; /* flags (FDENSITY for floppy) */ unsigned short side; /* side to be initialized */ unsigned short track; /* track to be initialized */ unsigned char *buf; /* pointer to track image */ } bm_init; /* Data structure for BMD_SEEK call */ typedef struct { unsigned char status; /* Return status */ unsigned char fe */ unsigned short count; /* number of bytes */ unsigned char *buf; /* pointer to firmware */ } bm_ldfrm; /* Flags */ #define LDFRM_DEBUG 0x8d /* Load debugger firmware */ #define LDFRM_FIRM 0x8f /* Load Regular firmware */ r *buf; /* buffer pointer */ unsigned short number; /* number of sectors to do */ unsigned short sector; /* starting sector number */ unsigned short surface; /* surface number to read/write */ unsigned short cylinder; /* cylinder number to read/write*/ } bm_prdwrt; /* Status bits primitive operations */ /* STDC */ #define STS_IOERROR 0x01 /* I/O error */ #define STS_NIOERROR 0x02  ; Version number BMD_SOFT defv 13 ; Accumulated number of retries BMD_HARD defv 14 ; Accumulated number of hard errors BMD_RETRY defv 15 ; Number of retries before hard error ; Floppy tape special numbers ; BMD_RETEN defv 64 ; Number of tape repositions before ; a retension ; IMI disk special numbers ; BMD_IMITYPE defv 64 ; Get type of IMI drive ; Values returned by BMD_IMITYPE ;  0x01 /* Device is write protected */ #define D3_INTRPT 0x02 /* Device interrupts */ #define D3_DUAL 0x04 /* Dual drive */ /* Floppy minor device number definition */ #define FDENSITY 0x40 /* 0=double density */ #define FSIDES 0x20 /* 0=double sided */ #define FDUAL 0x10 /* 1=dual drive (PERSCI) */ #define FDTRACK 0x08  */ /* SMD */ #define SMS_SELECT 0x01 /* Error on select */ #define SMS_HOME 0x02 /* Error on home */ #define SMS_SEEK 0x03 /* Error on seek */ #define SMS_READ 0x04 /* Error on read */ #define SMS_WRITE 0x05 /* Error on write */ #define SMS_HEAD 0x06 /* Error on select head */ #define SMS_PREAD 0x07 rror; /* Fatal error number */ unsigned char serror; /* System error number */ unsigned char verify; /* Verify seek flag */ unsigned short side; /* side */ unsigned short track; /* track */ } bm_seek; /* Data structure for BMD_RDWRT call */ typedef struct { unsigned short read; /* Read/write flag */ unsigned char *buf; /* buffer pointer ./equ/bmodeequ.z80 7421 77777 77777 7022 4026366743 7521 0;  IM_50070 defv 01H ; IMI model 50070 IM_5007W defv 02H ; IMI model 5007W IM_5018H defv 03H ; IMI model 5018H IM_7710A defv 04H ; IMI model 7710A IM_7710B defv 05H ; IMI model 7710B ; D-register & e-register bits for BMD_STATUS calls ; DS.BUSY defv 0 ; Device Busy (in use) DS.WANT defv 1 ; Device Wanted (do wakeup) DS.READ defv 2 ; Read-only device DS.MODF defv 3 ; Super key; /* Key */ }; /* Common mode bits */ #define IPC_ALLOC 0100000 /* Entry currently allocated */ #define IPC_CREAT 0001000 /* Create if key does not exist */ #define IPC_EXCL 0002000 /* Fail if key exists */ #define IPC_NOWAIT 0004000 /* Error instead of wait */ /* Keys */ #define IPC_PRIVATE 0 /* Private key */ /* Common control commands */ #defi defv 5 ; Uniform floppy D2.MEMORY defv 6 ; Processor memory D2.RAM defv 7 ; RAM disk D2.FTAPE defv 8 ; Floppy tape D2.IMI defv 9 ; IMI hard disk ; D-register & e-register bits for BMD_FLG3 calls ; D3.WRTPRO defv 0 ; Device is write protected D3.INTRPT defv 1 ; Device interrupts D3.DUAL defv 2 ; Dual drive ; Floppy minor device number bits ; FDENSITY defv 6 ; 0 = d list off ; ; Cromemco Inc. ; Jun 12, 1986 ; stdin equ 0 ;standard input channel stdout equ 1 ;standard output channel stderr equ 2 ;standard error channel ; ; D2 & D3 register modes for _create, _open ; op_read equ 0 ;read only op_write equ 1 ;write only op_rdwr equ 2 ;read and write op_append equ 3 ;append only op_xread equ 4 ;exclusive read only op_xwrite equ 5 ;exclusive write only op_xrdwr equ 6 ;excl./equ/ipc.h 7421 77777 77777 2335 4026366762 6304 0qu 8 ;D3 = number of links st_inum equ 9 ;D3 = inode number st_device equ 10 ;D3,D4 = device containing inode st_tcreate equ 11 ;D3 -> time created st_tmodify equ 12 ;D3 -> time last modified st_taccess equ 13 ;D3 -> time last accessed st_tdumped equ 14 ;D3 -> time last dumped st_devno equ 15 ;D3,D4 = device # if inode is device st_pdevno equ 16 ;D3,D4 = device # if inode is device st_stext equ 17 ;D3 = shared text attribute ; ; D2-regis-block modified DS.MOUNT defv 4 ; Device mounted DS.HOME defv 5 ; Device has been homed DS.BFSTEP defv 6 ; Buffered step flag DS.VERIFY defv 7 ; Verify after write ; D-register & e-register bits for BMD_FLG1 calls ; DF.SMALL defv 0 ; 1=small floppy 0=large floppy DF.DSIDE defv 1 ; Double sided DF.DDENS defv 2 ; Double density DF.DTRACK defv 3 ; Double tracked DF.CROMIX defv ne IPC_RMID 0 /* Remove identifier */ #define IPC_SET 1 /* Set options */ #define IPC_STAT 2 /* Get options */ ouble density FSIDES defv 5 ; 0 = double sided FDUAL defv 4 ; 1 = dual drive (PERSCI) FDTRACK defv 3 ; 1 = double tracked FSIZE defv 2 ; 0 = 8", 1 = 5" FUNIT defv 03H ; Mask for unit number ; SMD minor device number bits ; CONTROLLER defv 7 ; Controller number DRIVE defv 6 ; Drive number FIXED defv 5 ; Fixed flag PARTITION defv 1FH ; Partition number masusive read and write op_xappend equ 7 ;exclusive append only op_truncf equ 80H ;truncate on create flag op_condf equ 40H ;conditional create flag op_force equ 20H ;force open of block device ; ; D2-register file position modes for .setpos ; fwd_begin equ 0 ;forward from the beginning of the file fwd_current equ 1 ;forward from the current file position fwd_end equ 2 ;forward from the end of the file bak_current equ -1 ;backward from the current file /* File: ipc.h Interprocess communication EZ -- Oct 01, 1985 */ struct ipc_perm { unsigned short uid; /* Owner's user id */ unsigned short gid; /* Owner's group id */ unsigned short cuid; /* Creator's user id */ unsigned short cgid; /* Creator's group id */ unsigned short mode; /* Access mode */ unsigned short seq; /* Slot sequence number */ int ter modes for _ustat, _chstat ; usr_ctty equ 0 ;D3 = controlling tty device number usr_prior equ 1 ;D3 = process priority usr_parent equ 2 ;D3 = parent process id usr_memp equ 3 ;D3 = address of user code usr_mems equ 4 ;D3 = size of code memory usr_time equ 5 ;D3 = process time in miliseconds usr_ctime equ 6 ;D3 = children time in miliseconds usr_user equ 7 ;D3 = effective user id usr_group equ 8 ;D3 = effective group id usr_term  4 ; Cromix format disk DF.CDOS defv 5 ; Cdos format disk DF.BACKUP defv 6 ; Backup format disk DF.VOICE defv 7 ; 0=step 1=voice coil ; D-register values for BMD_FLG2 calls ; D2.SMALL defv 0 ; Small floppy D2.LARGE defv 1 ; Large floppy D2.STDC defv 2 ; STDC hard disk D2.FSMD defv 3 ; Fixed part of SMD hard disk D2.RSMD defv 4 ; Removable part of SMD hard disk D2.UNIFORM ./equ/jsysequ.asm 7421 77777 77777 32452 4026367001 7573 0k list xref, on position bak_end equ -2 ;backward from the end of the file ; ; D2-register modes for _fstat, _cstat, _fchstat, _cchstat ; st_all equ 0 ;all of inode (128 bytes) st_owner equ 1 ;D3 = owner st_group equ 2 ;D3 = group st_aowner equ 3 ;D3 = owner access, mask st_agroup equ 4 ;D3 = group access, mask st_aother equ 5 ;D3 = other access, mask st_ftype equ 6 ;D3 = file type, special device # st_size equ 7 ;D3 = file size st_nlinks e<  equ 9 ;D3 = terminal identification usr_hdevn equ 10 ;D3 = home directory device number usr_hinum equ 11 ;D3 = home directory inode number usr_cdevn equ 12 ;D3 = current directory device number usr_cinum equ 13 ;D3 = current directory inode number usr_static equ 14 ;D3 = programmable pointer ; ; file types for st_ftype ; is_ordin equ 0 ;ordinary file is_direct equ 1 ;directory file is_char equ 2 ;character device 1,A1) link to open channel _faccess equ 26H ;faccess(D2,A0) test file access _caccess equ 27H ;caccess(D1,D2) test channel access _ustat equ 28H ;ustat(D1,D2,D3) get process information _uchstat equ 29H ;uchstat(D1,D2,D3) set process information _msgget equ 2AH ;D3=msgget(D1,D2) get message queue identifier _msgsnd equ 2BH ;msgsnd(D1,D2,D3,A0) send message _msgrcv equ 2CH ;D3=msgrcv(D1,D2,D3,D4,A0) receive mL NUMBERS ; system calls commented out are not implemented in current version ; _makdev equ 00H ;makdev(D2,D3,D4,A0) make device entry _makdir equ 01H ;makdir(A0) make a directory _getdir equ 02H ;getdir(A0) get current directory name _setdir equ 03H ;setdir(A0) change current directory _mount equ 04H ;mount(D1,A0,A1) mount file system _unmount equ 05H ;unmount(D2,A0) unmount file system _delete e ;unlock(D2,D3,A0) unlock key _signal equ 40H ;A0=signal(D2,A0) set up to receive a signal _kill equ 41H ;kill(D2,D3) send a signal _sleep equ 42H ;sleep(D3) sleep D3 seconds _alarm equ 43H ;alarm(D3) set alarm clock _pause equ 44H ;pause() pause for alarm clock _wait equ 45H ;D1,D2,D3=wait(D1,D3) wait for child process _exit equ 46H ;exit(D3) exit process (closeH ;D0=rdbyte(D1) read 1 byte _wrbyte equ 17H ;wrbyte(D1,D0) write 1 byte _rdline equ 18H ;D3=rdline(D1,D3,A0) read a line _wrline equ 19H ;D3=wrline(D1,A0) write a line _phys equ 1AH ;phys(A0,D3,D2) access to phys memory _printf equ 1BH ;printf(D1,A0) print formatted string _error equ 1CH ;error(D0,D1,...) print error message _semget equ 1DH ;D3=semget(D1,D2,D4) get semaphore group id _semop equ 59H ;A0=shmat(D1,D2) attach shared memory _shmdt equ 5AH ;shmdt(D1,A0) dettach shared memory _shmctl equ 5BH ;shmctl(D1,D2,A0) shared memory control form ;* error code definitions -- RVH Jan 30,1979 ?badchan equ 1 ;bad channel # ?toomany equ 2 ;channel already open ?notopen equ 3 ;channel not open ?endfile equ 4 ;end-of-file ?ioerror equ 5 ;I/O error ?filtable equ is_block equ 3 ;block device is_pipe equ 4 ;pipe file ; ; access bits for access flags ; ac_read equ 0 ;read access bit ac_exec equ 1 ;execute access bit ac_writ equ 2 ;write access bit ac_apnd equ 3 ;append access bit ; ; D2 register modes for _setuser, _getuser, _setgroup, _getgroup ; id_effective equ 0 ;effective id id_login equ 1 ;login id id_program equ 2 essage _msgctl equ 2DH ;msgctl(D1,D2,A0) message control _zgetmode equ 2EH ; reserved for Z80.bin _zsetmode equ 2FH ; reserved for Z80.bin ; _getdate equ 30H ;D0,D1,D2,D3=getdate() get date _setdate equ 31H ;setdate(D1,D2,D3) set date _gettime equ 32H ;D1,D2,D3=gettime() get time _settime equ 33H ;settime(D1,D2,D3) set time _getuser equ 34H ;D3=getuser(D2) get user id _setuser qu 06H ;delete(A0) delete file _chkdev equ 07H ;chkdev(D2,D3,D4) check for device driver _create equ 08H ;D1=create(D2,D3,A0) create & open file _open equ 09H ;D1=open(D2,D3,A0) open file _chdup equ 0AH ;D2=chdup(D1) duplicate channel _close equ 0BH ;close(D1) close file _exchg equ 0CH ;exchg(D1,D2) exchange data in files _trunc equ 0DH ;trunc(D1) truncate open file _pipe files) ; equ 47H _fshell equ 48H ;D3=fshell(D1,D2,A1) fork a shell process _shell equ 49H ;shell(A1) transfer to shell process ; equ 4AH _fexec equ 4BH ;D3=fexec(D1,D2,A0,A1) fork and execute program _exec equ 4CH ;exec(A0,A1) execute program ; equ 4DH _ptrace equ 4EH ;ptrace(D1,D2,A0,A1,D3) trace user program ; equ 4FH _memory equ 50H ;A0=memory(A0,D1,D2,D3) allocate user memory _ind equ 1EH ;semop(D1,D2,A0) semaphore operation _semctl equ 1FH ;D3=semctl(D1,D2,D4,A0) semaphore control operation _fstat equ 20H ;D3=fstat(D2,A0,A1) get file status (inode) _cstat equ 21H ;D3=cstat(D1,D2,A1) get channel status (inode) _fchstat equ 22H ;fchstat(D2,D3,D4,A0,A1)change file status _cchstat equ 23H ;cchstat(D1,D2,D3,D4,A1)change channel status _flink equ 24H ;flink(A0,A1) link to file _clink equ 25H ;clink(D 6 ;file table exhausted ?notexist equ 7 ;file does not exist ?badname equ 8 ;bad file name ?diraccess equ 9 ;directory access ?filaccess equ 10 ;file access ?exists equ 11 ;file already exists ?nospace equ 12 ;no disk space left ?noinode equ 13 ;no inodes left ?inotable equ 14 ;inode table exhausted ?badcall equ 15 ;illegal system call ?filsize equ  ;program id id_d3 equ 3 ;id contained in D3 register ; ; signals ; sigabort equ 1 ; Abort signal siguser equ 2 ; User signal sigkill equ 3 ; Kill signal (not catchable) sigterm equ 4 ; Terminate signal (catchable) sigalarm equ 5 ; Alarm clock signal sigpipe equ 6 ; Broken pipe sighangup equ 7 ; Hang up ; equ 8 ; Reserved ; ; ; SYSTEM CALequ 35H ;setuser(D1,D2,D3) set user id _getgroup equ 36H ;D3=getgroup(D2) get group id _setgroup equ 37H ;setgroup(D1,D2,D3) set group id _getprior equ 38H ;D3=getprior() get process priority _setprior equ 39H ;setprior(D3) set process priority _getproc equ 3AH ;D3=getproc() get process id ; equ 3BH ; equ 3CH ; equ 3DH _lock equ 3EH ;lock(D2,D3,A0) lock key _unlock equ 3FH  equ 0EH ;D1,D2=pipe() create a pipe ; equ 0FH _getpos equ 10H ;D3=getpos(D1) get file position _setpos equ 11H ;setpos(D1,D2,D3) set file position _getmode equ 12H ;D3=getmode(D1,D2) get device characteristics _setmode equ 13H ;D3=setmode(D1,D2,D3,D4)set device characteristics _rdseq equ 14H ;D3=rdseq(D1,D3,A0) read D3 maximum bytes _wrseq equ 15H ;D3=wrseq(D1,D3,A0) write D3 bytes _rdbyte equ 16irect equ 51H ;indirect(D0...) system call in D0 register _update equ 52H ;update() update disk I/O buffers _mult equ 53H ;D3=D1*D2 32 bit multiply _divd equ 54H ;D3,D4=D1/D2 32 bit divide _version equ 55H ;D3=version() get system version # _boot equ 56H ;boot(A0,A1,D1) boot new system ; equ 57H _shmget equ 58H ;D3=shmget(D1,D2,D4) get shared memory identifier _shmat < 16 ;file size too big ?mnttable equ 17 ;mount table exhausted ?notdir equ 18 ;not a directory ?isdir equ 19 ;is a directory ?priv equ 20 ;privileged system call ?notblk equ 21 ;not a block special device ?fsbusy equ 22 ;file system busy ?notordin equ 23 ;not an ordinary file ?notmount equ 24 ;device not mounted ?nochild equ 25 ;no child processes ?nomemorye */ #define op_read 0 /* Read only */ #define op_write 1 /* Write only */ #define op_rdwr 2 /* Read and write */ #define op_append 3 /* Append only */ #define op_xread 4 /* Exclusive read only */ #define op_xwrite 5 /* Exclusive write only */ #define op_xrdwr 6 /* Exclusive read and write */ #define op_xappend 7 /* Ex?noproc equ 45 ;process does not exist ?signal equ 46 ;system call was aborted ?badpipe equ 47 ;bad call on a pipe ?locked equ 48 ;locked ?deadlock equ 49 ;deadlocked ?lcktable equ 50 ;lock table exhausted ?tapeio equ 51 ;tape I/O error ?badio equ 52 ;bad I/O ?noz80 equ 53 ;cannot run Z80 programs ?badformat equ 54 ;bad file format ?runaway  */ #define st_agroup 4 /* Group access, mask */ #define st_aother 5 /* Other access, mask */ #define st_ftype 6 /* File type, special device # */ #define st_size 7 /* File size */ #define st_nlinks 8 /* Number of links */ #define st_inum 9 /* Inode number */ #define st_device 10 /* Device containing inod./equ/jsysequ.h 7421 77777 77777 43034 4026367020 7241 0nds */ #define usr_ctime 6 /* Children time in miliseconds */ #define usr_user 7 /* Effective user id */ #define usr_group 8 /* Effective group id */ #define usr_term 9 /* Terminal identification */ #define usr_hdevn 10 /* Home directory device number */ #define usr_hinum 11 /* Home directory inode number */ #define usr_cdevn 12 /* Current dir equ 26 ;not enough memory ?ovflo equ 27 ;divide overflow ?argtable equ 28 ;argument table exhausted ?arglist equ 29 ;bad argument list ?numlinks equ 30 ;too many number of links ?difdev equ 31 ;cross-device link ?nodevice equ 32 ;no special device ?usrtable equ 33 ;user process table exhausted ?badvalue equ 34 ;value out of range ?notconn equ 35 ;I/O dclusive append only */ #define op_truncf 0x80 /* Truncate on create flag */ #define op_condf 0x40 /* Conditional create flag */ #define op_force 0x20 /* Force open on block device */ /* Modes for setpos system call */ #define fwd_begin 0 /* Forward from the beginning of the file */ #define fwd_current 1 /* Forward from the current position */ #define fwd_end 2 /* Forward from the end of the file */ #def equ 55 ;runaway program aborted ?cdossim equ 56 ;CDOS simmulator required ?corrupt equ 57 ;system image corrupted ?ipcaccess equ 58 ;IPC access error ?ipcspace equ 59 ;IPC insufficient space ?ipcexists equ 60 ;IPC facility already exists ?ipcnoent equ 61 ;IPC facility not found ?ipcremove equ 62 ;IPC facility removed ?ipcagain equ 63 ;IPC try again ?ipc2big equ 64 e */ #define st_tcreate 11 /* Time created */ #define st_tmodify 12 /* Time last modified */ #define st_taccess 13 /* Time last accessed */ #define st_tdumped 14 /* Time last dumped */ #define st_devno 15 /* Device number if inode is a device */ #define st_pdevno 16 /* Phys device # if inode is a device */ #define st_stext 17 /* Shared te/* Jsysequ.h: Cromemco C I/O header file Copyright (c) 1986 by Cromemco, Inc., All Rights Reserved This file contains declarations of all values which are used during calls to the Cromix-Plus operating system. Jul 31, 1986 */ /* Standard channel numbers */ #define STDIN 0 /* Standard input channel */ #define STDOUT 1 /* Standard output channel */ #define STDERR 2 /* Standard error channel */ /* Access modes for createctory device number */ #define usr_cinum 13 /* Current directory inode number */ #define usr_static 14 /* Programmable pointer */ /* File types for st_ftype */ #define is_ordin 0 /* Ordinary file */ #define is_direct 1 /* Directory file */ #define is_char 2 /* Character device */ #define is_block 3 /* Block device evice not connected ?devopen equ 36 ;device open error ?diruse equ 37 ;directory in use (delete) ?filuse equ 38 ;file in use (exclusive access) ?nomatch equ 39 ;no match on ambiguous name ?chnaccess equ 40 ;channel access ?notcromix equ 41 ;not a cromix disk ?badfree equ 42 ;bad free list ?badinum equ 43 ;bad inode number ?readonly equ 44 ;device mounted for read only ine bak_current -1 /* Backward from the current file position */ #define bak_end -2 /* Backward from the end of the file */ /* Status types for _fstat, _cstat, _fchstat, _cchstat */ #define st_all 0 /* All of inode (128 bytes) */ #define st_owner 1 /* Owner */ #define st_group 2 /* Group */ #define st_aowner 3 /* Owner access, mask  ;IPC facility too big ?ipcnomsg equ 65 ;IPC no message waiting ?ipcrange equ 66 ;IPC range error ?ptable equ 67 ;Out of page tables ?nostext equ 68 ;Out of shared text tables ?badaddress equ 69 ;Bad address list on xt attribute */ /* Status types for _ustat, _uchstat */ #define usr_ctty 0 /* Controlling tty device number */ #define usr_prior 1 /* Process priority */ #define usr_parent 2 /* Parent process id */ #define usr_memp 3 /* Address of user code */ #define usr_mems 4 /* Size of code memory */ #define usr_time 5 /* Process time in miliseco=  */ #define is_pipe 4 /* Pipe file */ /* Mask values for file access flags */ #define ac_read 0x01 /* Read access bit */ #define ac_exec 0x02 /* Execute access bit */ #define ac_writ 0x04 /* Write access bit */ #define ac_apnd 0x08 /* Append access bit */ /* Id types and values for _setuser, _getuser, _setgroup, _getgroup */ #definet 0x20 /* Get file status (inode) */ #define _cstat 0x21 /* Get channel status (inode) */ #define _fchstat 0x22 /* Change file status */ #define _cchstat 0x23 /* Change channel status */ #define _flink 0x24 /* Link to file */ #define _clink 0x25 /* Link to open channel */ #define _faccess 0x26 /* Test file access */ #define SIGTERM (1 << sigterm - 1) #define SIGALARM (1 << sigalarm - 1) #define SIGPIPE (1 << sigpipe - 1) #define SIGHANGUP (1 << sighangup- 1) /* Cromix-Plus System Call Numbers */ #define _makdev 0x00 /* Make device entry */ #define _makdir 0x01 /* Make a directory */ #define _getdir 0x02 /* Get current directory name */ #define _setdir 0x03 /* Change current directory  */ #define _setuser 0x35 /* Set user id */ #define _getgroup 0x36 /* Get group id */ #define _setgroup 0x37 /* Set group id */ #define _getprior 0x38 /* Get the current process priority */ #define _setprior 0x39 /* Set the current process priority */ #define _getproc 0x3A /* Get process id */ #define _lock 0x3E /*device characteristics */ #define _setmode 0x13 /* Set device characteristics */ #define _rdseq 0x14 /* Read n bytes */ #define _wrseq 0x15 /* Write n bytes */ #define _rdbyte 0x16 /* Read 1 byte */ #define _wrbyte 0x17 /* Write 1 byte */ #define _rdline 0x18 /* Read a line */ #define _wrline 0x */ #define _ptrace 0x4E /* Debug system call */ #define _memory 0x50 /* Allocate user memory */ #define _indirect 0x51 /* System call in D0-register */ #define _update 0x52 /* Update disk I/O buffers */ #define _mult 0x53 /* Multiply */ #define _divd 0x54 /* Divide */ #define _version 0x55 /* Get system vers id_effective 0 /* Effective id */ #define id_login 1 /* Login id */ #define id_program 2 /* Program id */ #define id_number 3 /* Id contained in idnumber */ /* Signal types */ #define sigabort 1 /* Control-C key */ #define siguser 2 /* User specifiable key */ #define sigkill 3 /* Kill sig#define _caccess 0x27 /* Test channel access */ #define _ustat 0x28 /* Get process table information */ #define _uchstat 0x29 /* Change process table information */ #define _msgget 0x2A /* Get message queue */ #define _msgsnd 0x2B /* Send message */ #define _msgrcv 0x2C /* Receive message */ #define _msgctl 0x2D /* Message control  */ #define _mount 0x04 /* Mount file system */ #define _unmount 0x05 /* Unmount file system */ #define _delete 0x06 /* Delete file */ #define _chkdev 0x07 /* Check for device driver */ #define _create 0x08 /* Create & open file */ #define _open 0x09 /* Open file */ #define _chdup 0x0A /* Duplicate channel  Lock key */ #define _unlock 0x3F /* Unlock key */ #define _signal 0x40 /* Set up to receive a signal */ #define _kill 0x41 /* Send a signal */ #define _sleep 0x42 /* Sleep for specified number of secs */ #define _alarm 0x43 /* Set alarm clock */ #define _pause 0x44 /* Pause for alarm clock */ #define _wait 19 /* Write a line */ #define _phys 0x1A /* Access physical addresses */ #define _printf 0x1B /* Print formatted string */ #define _error 0x1C /* Print error message */ #define _semget 0x1D /* Get semaphore identifier */ #define _semop 0x1E /* Semaphore operation */ #define _semctl 0x1F /* Semaphore control */ #define _fstaion # */ #define _boot 0x56 /* Boot new operating system */ /* Reserved */ #define _shmget 0x58 /* Get shared memory identifier */ #define _shmat 0x59 /* Attach shared memory */ #define _shmdt 0x5A /* Dettach shered memory */ #define _shmctl 0x5B /* Shared memory control */ /* Cromix-Plus error numbers */ #define _badchan 1 nal */ #define sigterm 4 /* Terminate */ #define sigalarm 5 /* Alarm */ #define sigpipe 6 /* Broken pipe signal */ #define sighangup 7 /* Modem hang up */ /* Reserved */ #define SIGABORT (1 << sigabort - 1) #define SIGUSER (1 << siguser - 1) #define SIGKILL (1 << sigkill - 1)  */ #define _zgetmode 0x2E /* Reserved for Z80.bin */ #define _zsetmode 0x2F /* Reserved for Z80.bin */ #define _getdate 0x30 /* Get date */ #define _setdate 0x31 /* Set date */ #define _gettime 0x32 /* Get time */ #define _settime 0x33 /* Set time */ #define _getuser 0x34 /* Get user id  */ #define _close 0x0B /* Close file */ #define _exchg 0x0C /* Exchange the contents of two inodes */ #define _trunc 0x0D /* Truncate open file */ #define _pipe 0x0E /* Generate a pipe */ #define _getpos 0x10 /* Get file position */ #define _setpos 0x11 /* Set file position */ #define _getmode 0x12 /* Get  0x45 /* Wait for child process */ #define _exit 0x46 /* Exit process (close files) */ /* Reserved */ #define _fshell 0x48 /* Fork a shell process */ #define _shell 0x49 /* Transfer to shell process */ #define _fexec 0x4B /* Fork and execute program */ #define _exec 0x4C /* Execute program */ /* Reserved =  /* Bad channel # */ #define _toomany 2 /* Channel already open */ #define _notopen 3 /* Channel not open */ #define _endfile 4 /* End-of-file */ #define _ioerror 5 /* I/O error */ #define _filtable 6 /* File table exhausted */ #define _notexist 7 /* File does not exist */ #define _badna/ #define _cdossim 56 /* CDOS simulator required */ #define _corrupt 57 /* System image corrupted */ #define _ipcaccess 58 /* IPC access error */ #define _ipcspace 59 /* IPC insufficient space */ #define _ipcexists 60 /* IPC facility already exists */ #define _ipcnoent 61 /* IPC facility not found */ #define _ipcremove 62 /* IPC facility removed  */ #define _fsbusy 22 /* File system busy */ #define _notordin 23 /* Not an ordinary file */ #define _notmount 24 /* Device not mounted */ #define _nochild 25 /* No child processes */ #define _nomemory 26 /* Not enough memory */ #define _ovflo 27 /* Divide overflow */ #define _argtable 28 /* Argument table ./equ/jsysequ.z80 7421 77777 77777 30212 4026367037 7435 042 /* Bad free list */ #define _badinum 43 /* Bad inode number */ #define _readonly 44 /* Device mounted for read only */ #define _noproc 45 /* Process does not exist */ #define _ssignal 46 /* System call was aborted */ #define _badpipe 47 /* Bad call on pipe */ #define _locked 48 /* Locked */ #define _de ; ; C-register file position modes for .setpos ; fwd.begin equ 0 ;forward from the beginning of the file fwd.current equ 1 ;forward from the current file position fwd.end equ 2 ;forward from the end of the file bak.current equ -1 ;backward from the current file position bak.end equ -2 ;backward from the end of the file ; ; C-register modes for .fstat, .cstat, .fchstat, .cchstat ; st.all equ 0 ;all of inode (128 bytes) st.owner equ 1 ;de = owner st.gme 8 /* Bad file name */ #define _diraccess 9 /* Directory access */ #define _filaccess 10 /* File access */ #define _exists 11 /* File already exists */ #define _nospace 12 /* No disk space left */ #define _noinode 13 /* No inodes left */ #define _inotable 14 /* Inode table exhausted */ # */ #define _ipcagain 63 /* IPC try again */ #define _ipc2big 64 /* IPC facility too big */ #define _ipcnomsg 65 /* IPC no message waiting */ #define _ipcrange 66 /* IPC range error */ #define _ptable 67 /* Out of page tables */ #define _nostext 68 /* Out of shared text tables */ #define _badaddress 69 /* Bad address exhausted */ #define _arglist 29 /* Arg list too big */ #define _numlinks 30 /* Too many number of links */ #define _difdev 31 /* Cross-device link */ #define _nodevice 32 /* No special device */ #define _usrtable 33 /* User process table exhausted */ #define _badvalue 34 /* Value out of range */ #define _notconn 35 /* I/ list off,noxref ; ; Cromemco Inc. ; Jan 23, 1986 ; stdin equ 0 ;standard input channel stdout equ 1 ;standard output channel stderr equ 2 ;standard error channel argc equ 40H ;location for argument count argv equ 42H ;location for argument list vector arg0 equ 0 ;arg offset arg1 equ 2 ;arg offset arg2 equ 4 ;arg offset arg3 equ 6 ;arg offset arg4 equ 8 ;arg offset ; ; C-register madlock 49 /* Deadlocked */ #define _lcktable 50 /* Lock table exhausted */ #define _tapeio 51 /* Tape I/O error */ #define _badio 52 /* I/O error */ #define _noz80 53 /* Cannot run Z80 programs */ #define _badformat 54 /* Bad file format */ #define _runaway 55 /* Runaway program aborted *roup equ 2 ;de = group st.aowner equ 3 ;d = owner access, e = mask st.agroup equ 4 ;d = group access, e = mask st.aother equ 5 ;d = other access, e = mask st.ftype equ 6 ;d = file type st.size equ 7 ;dehl = file size st.nlinks equ 8 ;de = number of links st.inum equ 9 ;de = inode number st.device equ 10 ;de = device number of file system containing inode st.tcreate equ 11 ;de-> time created st.tmodify equ 12 ;de-> time define _badcall 15 /* Illegal system call */ #define _filsize 16 /* File size too big */ #define _mnttable 17 /* Mount table exhausted */ #define _notdir 18 /* Not a directory */ #define _isdir 19 /* Is a directory */ #define _priv 20 /* Privileged system call */ #define _notblk 21 /* Not a block special device  */ O device not connected */ #define _devopen 36 /* Device open error */ #define _diruse 37 /* Directory in use (delete) */ #define _filuse 38 /* File in use (exclusive access) */ #define _nomatch 39 /* No match on ambiguous name */ #define _chnaccess 40 /* Channel access */ #define _notcromix 41 /* Not a cromix disk */ #define _badfree odes for .create, .open ; op.read equ 0 ;read only op.write equ 1 ;write only op.rdwr equ 2 ;read and write op.append equ 3 ;append only op.xread equ 4 ;exclusive read only op.xwrite equ 5 ;exclusive write only op.xrdwr equ 6 ;exclusive read and write op.xappend equ 7 ;exclusive append only op.truncf equ 80H ;truncate on create flag op.condf equ 40H ;conditional create flag op.force equ 20H ;force open of block device> last modified st.taccess equ 13 ;de-> time last accessed st.tdumped equ 14 ;de-> time last dumped st.devno equ 15 ;de = device number if inode is a device st.pdevno equ 16 ;de = physical device number if inode is a device st.stext equ 17 ;d = shared text attribute ; ; file types for st.ftype ; is.ordin defl 0 ;ordinary file is.direct defl 1 ;directory file is.char defl 2 ;character device is.block defl 3 ;blo get message queue .msgsnd equ 2BH ;msgsnd(bc,de,hl,bc') message send .msgrcv equ 2CH ;de=msgrcv(bc,de,hl,bc'dehl') message receive ; equ 2DH .getdate equ 30H ;d,e,h,l=getdate() get date .setdate equ 31H ;setdate(e,h,l) set date .gettime equ 32H ;e,h,l=gettime() get time .settime equ 33H ;settime(e,h,l) set time .getuser equ 34H ;de,hl=getuser() get user id .setuser equ 35H ;setuser(hl) seentry .makdir equ 01H ;makdir(hl) make a directory .getdir equ 02H ;getdir(hl) get current directory name .setdir equ 03H ;setdir(hl) change current directory .mount equ 04H ;mount(c,de,hl) mount file system .unmount equ 05H ;unmount(hl) unmount file system .delete equ 06H ;delete(hl) delete file .chkdev equ 07H ;chkdev(d,e) check for device driver .create equ 08H ;shell equ 48H ;fshell(de) fork a shell process .shell equ 49H ;shell(de) transfer to shell process ; equ 4AH .fexec equ 4BH ;fexec(bc,de,hl) fork and execute program .exec equ 4CH ;exec(bc,de,hl) execute program ;.execz80 equ 4DH execute z80 program ;.ptrace equ 4EH ; equ 4FH ;.memory equ 50H allocate memory .indirect equ 51H ;indirect(a,b,ead a line .wrline equ 19H ;de=wrline(b,hl) write a line ; equ 1AH .printf equ 1BH ;printf(b,hl) print formatted string .error equ 1CH ;error(a,b,de,hl) print error message .semget equ 1DH ;bc=semget(bc,de,hl,dehl') get semaphore id .semop equ 1EH ;semop(bc,de,hl) semaphore operation ; equ 1FH .fstat equ 20H ;fstat(c,de,hl) get file status (inode) .cstat equ 21H ;cstat(b,c,de) getnot exist ?badname defv 8 ;bad file name ?diraccess defv 9 ;directory access ?filaccess defv 10 ;file access ?exists defv 11 ;file already exists ?nospace defv 12 ;no disk space left ?noinode defv 13 ;no inodes left ?inotable defv 14 ;inode table exhausted ?badcall defv 15 ;illegal system call ?filsize defv 16 ;file size too big ?mnttable defv 17 ;mount table exhck device is.pipe defl 4 ;pipe file ; ; access bits for access flags ; ac.read defl 0 ;read access bit ac.exec defl 1 ;execute access bit ac.writ defl 2 ;write access bit ac.apnd defl 3 ;append access bit ; ; C-register modes for .setuser, .getuser, .setgroup, .getgroup ; id.effective equ 0 ;effective id id.login equ 1 ;login id id.program equ 2 ;program id id.hl equ t user id .getgroup equ 36H ;de,hl=getgroup() get group id .setgroup equ 37H ;setgroup(hl) set group id .getprior equ 38H ;l=getprior() get process priority .setprior equ 39H ;setprior(l) set process priority .getproc equ 3AH ;hl=getproc() get process id ; equ 3BH ; equ 3CH ; equ 3DH .lock equ 3EH ;lock(c,de,hl) lock key .unlock equ 3FH ;unlock(c,de,hl) unlock keyb=create(c,hl) create & open file .open equ 09H ;b=open(c,hl) open file .chdup equ 0AH ;c=chdup(b) duplicate channel .close equ 0BH ;close(b) close file .exchg equ 0CH ;exchg(b,c) exchange data in files .trunc equ 0DH ;trunc(b) truncate open file .pipe equ 0EH ;b,c=pipe() create a pipe ; equ 0FH .getpos equ 10H ;dehl=getpos(b) get file positioc,de,hl) system call in A-register .update equ 52H ;update() update disk I/O buffers .mult equ 53H ;dehl=mult(bc,hl) multiply .divd equ 54H ;de,hl=divd(dehl,bc) divide .version equ 55H ;hl=version() get system version # .boot equ 56H ;boot(hl,de) boot new operating system .memove equ 57H ;memove(bc,de,hl,dehl') memory move .shmget equ 58H ;bc=shmget(bc,dehl,dehl') get shared memory id .shmat equ  channel status (inode) .fchstat equ 22H ;fchstat(c,de,hl) change file status .cchstat equ 23H ;cchstat(b,c,de) change channel status .flink equ 24H ;flink(de,hl) link to file .clink equ 25H ;clink(b,de) link to open channel .faccess equ 26H ;faccess(c,hl) test file access .caccess equ 27H ;caccess(b,c) test channel access ; equ 28H ; equ 29H .msgget equ 2AH ;bc=msgget(de,dehl') austed ?notdir defv 18 ;not a directory ?isdir defv 19 ;is a directory ?priv defv 20 ;privileged system call ?notblk defv 21 ;not a block special device ?fsbusy defv 22 ;file system busy ?notordin defv 23 ;not an ordinary file ?notmount defv 24 ;device not mounted ?nochild defv 25 ;no child processes ?nomemory defv 26 ;not enough memory ?ovflo defv 27 ; 3 ;id contained in HL register ; ; Signals ; sigabort defv 1 ;CNTRL-C key siguser defv 2 ;user-specifiable key sigkill defv 3 ;kill sigterm defv 4 ;terminate (catchable) sigalarm defv 5 ;alarm clock sigpipe defv 6 ;broken pipe sighangup defv 7 ;modem hang up ; defv 8 ;reserved ; ; SYSTEM CALL NUMBERS ; .makdev equ 00H ;makdev(d,e,hl) make device  .signal equ 40H ;signal(c,hl) set up to receive a signal .kill equ 41H ;kill(c,hl) send a signal .sleep equ 42H ;sleep(hl) sleep for hl seconds .alarm equ 43H ;alarm(hl) set alarm clock .pause equ 44H ;pause() pause for alarm clock .wait equ 45H ;c,de,hl=wait() wait for child process .exit equ 46H ;exit(hl) exit process (close files) ; equ 47H .fn .setpos equ 11H ;setpos(c,dehl) set file position .getmode equ 12H ;d=getmode(b,c) get device characteristics .setmode equ 13H ;d=setmode(b,c,d,e) set device characteristics .rdseq equ 14H ;de=rdseq(b,de,hl) read n bytes .wrseq equ 15H ;de=wrseq(b,de,hl) write n bytes .rdbyte equ 16H ;a=rdbyte(b) read 1 byte .wrbyte equ 17H ;wrbyte(b,a) write 1 byte .rdline equ 18H ;de=rdline(b,de,hl) r59H ;dehl'=shmat(bc,de) attach shared memory .shmdtt equ 5AH ;shmdt(dehl') dettach shared memory ; equ 5BH form ;* error code definitions ?badchan defv 1 ;bad channel # ?toomany defv 2 ;channel already open ?notopen defv 3 ;channel not open ?endfile defv 4 ;end-of-file ?ioerror defv 5 ;I/O error ?filtable defv 6 ;file table exhausted ?notexist defv 7 ;file does > divide overflow ?argtable defv 28 ;argument table exhausted ?arglist defv 29 ;bad argument list ?numlinks defv 30 ;too many number of links ?difdev defv 31 ;cross-device link ?nodevice defv 32 ;no special device ?usrtable defv 33 ;user process table exhausted ?badvalue defv 34 ;value out of range ?notconn defv 35 ;I/O device not connected ?devopen defv 36 ;device open error ?dir /* ksnext(name,record) */ #define _ksprevious 9 /* ksprevious(name,record) */ #define _ksfirst 10 /* ksfirst(name,keypos,record) */ #define _kslast 11 /* kslast(name,keypos,record) */ #define _ksphfirst 12 /* ksphfirst(name,record) */ #define _ksphnext 13 /* ksphnext(name,record) */ #define _ksaddrec 14 /* ksaddrec(name,record) */ #define fv 57 ;system image corrupted ?ipcaccess defv 58 ;IPC access error ?ipcspace defv 59 ;IPC insufficient space ?ipcexists defv 60 ;IPC facility already exists ?ipcnoent defv 61 ;IPC facility not found ?ipcremove defv 62 ;IPC facility removed ?ipcagain defv 63 ;IPC try again ?ipc2big defv 64 ;IPC facility too big ?ipcnomsg defv 65 ;IPC no message waiting ?ipcrange defv 66 ;IPC ran1006 /* Ksam limitations exceeded */ #define KS_CREATE 1007 /* Create error */ #define KS_EXISTS 1009 /* Ksam system already exists */ #define KS_OPEN 1010 /* Open error */ #define KS_NOTFOUND 1011 /* Key not found */ #define KS_BADKEY 1012 /* Invalid key specification */ #define KS_LONGKEY 1013 /* Specified key too long */ #define KS_/* File: Ksam.h Dec 17, 1985 */ /* System parameters */ #define RECORDSIZE 2048 /* Maximum record size */ #define NUMPARTS 7 /* Maximum number of key parts */ #define PATHLEN 64 /* Pathname length */ #define MAXKEYSIZE 116 /* Maximum key size including tag */ /* Function codes */ #define _ksstart 0 /* ksstart(lockname) */ #define _ksbuild 1 /* ksbuild(name, */ use defv 37 ;directory in use (delete) ?filuse defv 38 ;file in use (exclusive access) ?nomatch defv 39 ;no match on ambiguous name ?chnaccess defv 40 ;channel access ?notcromix defv 41 ;not a cromix disk ?badfree defv 42 ;bad free list ?badinum defv 43 ;bad inode number ?readonly defv 44 ;device mounted for read only ?noproc defv 45 ;process does not exist ?signal def_ksdelrec 15 /* ksdelrec(name) */ #define _ksclose 16 /* ksclose(name) */ #define _ksretcurrent 17 /* ksretcurrent(name,record) */ #define _ksretuniqueid 18 /* ksretuniqueid(name,id) */ #define _ksposition 19 /* ksposition(name,keypos,keyval,keylen) */ #define _ksupdate 20 /* ksupdate(name,record) */ #define _ksstop 21 /* ksstop() ge error ?ptable defv 67 ;Out of page tables ?nostext defv 68 ;Out of shared text tables list on,xref EOF 1016 /* End of file on forward move */ #define KS_CURRENT 1017 /* There is no current record */ #define KS_IOERROR 1025 /* I/O error */ #define KS_EMPTY 1040 /* Empty data base */ #define KS_NOTOPEN 1045 /* Ksam system has not be opened */ #define KS_USER 1060 /* Too many active users */ #define KS_BADCALL 1061 /* Illegal call number recsize,access) */ #define _ksaddkey 2 /* ksaddkey(name,keypos,dupsarray) */ #define _ksdelkey 3 /* ksdelkey(name,keypos) */ #define _ksrename 4 /* ksrename(oldname,newname) */ #define _kserase 5 /* kserase(name) */ #define _ksopen 6 /* ksopen(name) */ #define _ksread 7 /* ksread(name,keypos,keyval,keylen,rec) */ #define _ksnext 8 ./equ/modeequ.asm 7421 77777 77777 20574 4026367076 7545 0v 46 ;system call was aborted ?badpipe defv 47 ;bad call on a pipe ?locked defv 48 ;locked ?deadlock defv 49 ;deadlocked ?lcktable defv 50 ;lock table exhausted ?tapeio defv 51 ;tape I/O error ?badio defv 52 ;bad I/O ;reserved ?badformat defv 54 ;bad file format ?runaway defv 55 ;runaway program aborted ?cdossim defv 56 ;CDOS simulator required ?corrupt de */ #define _kslock 98 /* kslock(string,length,type) */ #define _ksunlock 99 /* ksunlock(string,length,type) */ /* Error codes */ #define KS_NEXT 1000 /* Not found, next returned */ #define KS_DUPKEY 1003 /* Duplicate key */ #define KS_BOF 1004 /* Beginning of file on backward move */ #define KS_RECSIZE 1005 /* Illegal record size */ #define KS_TOOMANY ./equ/ksam.h 7421 77777 77777 10020 4026367056 6467 0*/ #define KS_CLOSE 1062 /* Close error */ #define KS_KEYEXISTS 1063 /* Such a key is already defined */ #define KS_ALREADY 1064 /* Ksam system already open */ #define KS_NOKEY 1065 /* No such key */ #define KS_BUSY 1066 /* Ksam system busy */ #define KS_START 1067 /* Ksam communications start error */ #define KS_INIT 1068 /* User did not start Ksam ?  list off list noxref ; ; Cromemco Inc. ; Jun 05, 1986 ; ; ----------------------------------------------------------------------------- ; mode definitions for terminals and printers, ; TTY, QTTY, MTTY, LPT, SLPT, QSLPT, and TYP ; D2-register values for _GETMODE and _SETMODE system calls MD_ISPEED equ 0 ; input speed MD_OSPEED equ 1 ; output speed MD_MODE1 equ 2 ; flags: RAW, ECHO, etc. MD_MODED equ 3 , ; no output PAUSE or output width truncation, ; treat X-OFF & X-ON as regular input. ODD equ 6 ; parity function bits EVEN equ 7 ; ; special definition for the big version of the TYP printer driver AUTOPRO equ RAW ; automatic proportional spacing ; D3-register & D4-register values for MD_MODED calls NLDELAY equ 03H ; (pairs of bits) TABDELAY equ 0CH ; CRDELAY equ 30H ; FFDELAY equ  ; line height in 1/48 in. TYP_LMARGIN equ 66 ; left margin in 1/10 in. ; more D2-register values for _GETMODE and _SETMODE system calls MD_STATUS equ 156 ; check whether input queues empty MD_IFLUSH equ 155 ; flush input queues MD_FNKEYS equ 152 ; turn function keys on or off ; D3-register = 1 to enable fnkeys ; D3-register = 0 to disable them MD_PSIGHUP equ 151 ; signal current procTTY device if modem hangs up CBREAK equ 4 ; on input, return after each character, ; no erase, linekill, or EOF characters. BINARY equ 5 ; on input, return after each character, ; no erase, linekill, or EOF characters, ; no output PAUSE or output width truncation, ; treat X-OFF & X-ON as regular input, ; no tandem mode (i.e., no input buf control), ; no abort signal (^C), no user signal, ; no changing or checking parity bit, ; no delays a equ 12 ; 4800 baud S_9600 equ 13 ; 9600 baud ; equ 14 ; External A ; equ 15 ; External B S_19200 equ 16 ; 19200 baud S_CTSWAIT equ 125 ; wait for Clear To Send S_NOCHG equ 126 ; no change of baudrate S_UNINIT equ 127 ; baudrate has not been initialized yet Sfl_AUTO equ 7 ; (bit 7) input CRs from keyboard to sey ; _SETMODE D3-register and D4-register bits for MD_MODEM calls RTS equ 1 ; Request to Send TXBREAK equ 4 ; Break the transmitter line DTR equ 7 ; Data Terminal Ready ; _GETMODE D3-register bits for MD_TYP calls TYPCHK equ 1 ; the 3355 printer is in a check condition TYPPAP equ 2 ; the 3355 printer is out of paper TYPRIB equ 3 ; the 3355 printer is out of ribbon TYPOFL equ  ; delays for NL, CR, etc. MD_MODE2 equ 4 ; flags: PAUSE, XFF, etc. MD_MODE3 equ 5 ; flags: CBREAK, VRAW, etc. MD_ERASE equ 6 ; auxilliary erase character MD_DELECHO equ 7 ; erasure echo character MD_LKILL equ 8 ; line kill character MD_USIGNAL equ 9 ; SIGUSER signal key MD_LENGTH equ 10 ; page length (lines) MD_WIDTH equ 11  40H ; (single bits) BSDELAY equ 80H ; ; D3-register & D4-register bits for MD_MODE2 calls PAUSE equ 0 ; wait for CNTRL-Q after a page is output NOTIMMECHO equ 1 ; do not echo characters typed-ahead NOECNL equ 2 ; do not echo NLs SGENABLE equ 3 ; send SIGUSER signal if MD_USIGNAL key pushed ABENABLE equ 4 ; send SIGABORT signal if CNTRL-C key pushed XFF equ 5 ; expand FFs WRAP ess if hang up ; equ 150 ; (this value reserved) ; equ 149 ; output break (QTTYs only) ; D3-register = 1 to start break ; D3-register = 0 to stop break MD_MODEM equ 148 ; (QTTYs and MTTYs only) MD_TYP equ 147 ; (TYP only) ; D3-register values for MD_ISPEED baudrate calls S_HANGUP equ 0 ; hang up phone ; equ 1 ; 50 baud ; fter control chars such as NLs, ; no echoing, ; no character transformations (i.e., ignore ; the LCASE, CRDEV, and XTABS modes) ; no function-key decoding. CRIGNORE equ 6 ; On output, ignore CR, change LF to CR DISCARD equ 7 ; discard the device when it is no longer open ; D3-register bits for MD_STATUS calls INOTEMPTY equ 0 ; there is a character in the input buffer ; (but if not CBREAK, RAW, or BINARY mode, ; it won't be accessibt baudr ; D3-register & D4-register bits for MD_MODE1 calls TANDEM equ 0 ; send XOFF/XON to control filling of input buf XTAB equ 1 ; expand TABs LCASE equ 2 ; convert alphabetics to lower case ECHO equ 3 ; echo input CRDEVICE equ 4 ; on input, map CR into NL, ; on output, change NL to CRLF. RAW equ 5 ; on input, return after each character, ; no erase, linekill, or EOF characters 4 ; the 3355 printer is off-line ; _GETMODE D3-register values for MD_IDENT calls ID_TTY equ 0 ; Tuart terminal ID_QTTY equ 1 ; Quadart or Octart terminal ID_LPT equ 2 ; Parallel printer ID_TYP equ 3 ; Fully formed printer ID_SLPT equ 4 ; Serial printer ID_QSLPT equ 5 ; Serial printer on quadart ID_CNET equ 6 ; CNET driver ID_FFP equ 7 ; FFP processor dri ; page width (columns) MD_BMARGIN equ 12 ; bottom margin (lines) MODELEN equ MD_BMARGIN + 1 MD_FORMS equ 254 ; printer forms number MD_IDENT equ 255 ; device identification ; more D2-register values for SLPT only SLPT_BSIZE equ MD_ERASE ; ETX/ACK block size ; more D2-register values for TYP only TYP_CWIDTH equ 64 ; character width in 1/120 in. TYP_LHEIGHT equ 65  equ 6 ; wrap-around if page width is exceeded SIGALLC equ 7 ; send SIGUSER signal for every key pushed ; D3-register & D4-register bits for MD_MODE3 calls ESCRETN equ 0 ; ESC causes input line to be returned FNKEYS equ 1 ; response to 3102 function keys enabled HUPENAB equ 2 ; hang up modem when device is finally closed SIGHUPALL equ 3 ; send SIGHANGUP signals to all processes which ; use this  equ 2 ; 75 baud S_110 equ 3 ; 110 baud ; equ 4 ; 134.5 baud S_150 equ 5 ; 150 baud ; equ 6 ; 200 baud S_300 equ 7 ; 300 baud ; equ 8 ; 600 baud S_1200 equ 9 ; 1200 baud ; equ 10 ; 1800 baud S_2400 equ 11 ; 2400 baud S_4800 le until a whole line ; is entered) ; _GETMODE D3-register bits for MD_MODEM calls RXDA equ 0 ; Receiver Data Available TXBE equ 2 ; Transmitter Buffer Empty DCD equ 3 ; Data Carrier Detect CTS equ 5 ; Clear To Send RXBREAK equ 7 ; Reciver data line broken ; _GETMODE D4-register bits for MD_MODEM calls notRI equ 6 ; Not ringing notDSR equ 7 ; Data Set not Read? ver ID_SYSTEM equ 8 ; System device ID_TIMER equ 9 ; Timer device ID_TAPE equ 10 ; Half inch tape drive ID_SCC equ 11 ; SCC terminal ID_FFP equ 12 ; Maximizer ; Values 13 .. 127 reserved ; Values 128 .. 255 reserved for user ; defined drivers and devices list xref list on 9 /* 1200 baud */ /* 10 1800 baud */ #define S_2400 11 /* 2400 baud */ #define S_4800 12 /* 4800 baud */ #define S_9600 13 /* 9600 baud */ /* 14 External A */ /* 15 External B */ #define S_19200 16 /* 19200 baud */ #define S_CTSWAIT 125 /* wait for clear to send  delays for NL, CR, etc. */ #define MD_MODE2 4 /* flags: PAUSE, XFF, etc. */ #define MD_MODE3 5 /* flags: ESCRETN */ #define MD_ERASE 6 /* auxilliary erase character */ #define MD_DELECHO 7 /* erasure echo character */ #define MD_LKILL 8 /* line kill character */ #define MD_USIGNAL 9 /* user signal key */ #define MD_LENGTH 10  0x80 /* contents of the D3-register & D4-register for MD_MODED calls */ #define NLDELAY 0x03 /* (pairs of bits) */ #define TABDELAY 0x0C #define CRDELAY 0x30 #define FFDELAY 0x40 /* (single bits) */ #define BSDELAY 0x80 /* contents of the D3-register & D4-register for MD_MODE2 calls */ #define PAUSE 0x01 /* wait for CNTRL-Q after a page */ /* is output ueues */ #define MD_IFLUSH 155 /* flush input queues */ #define MD_FNKEYS 152 /* turn function keys on or off */ #define MD_PSIGHUP 151 /* signal current process if hang up */ #define MD_MODEM 148 /* (QTTY and MTTYs only) */ #define MD_TYP 147 /* (TYPs only) */ /* contents of D3-register for MD_ISPEED calls to change the baudrate */ #define S_HANGUP 0 /* hang up * which use this tty if modem hangs up */ #define CBREAK 0x10 /* on input, return after each character, */ /* no erase, linekill, or eof characters */ #define BINARY 0x20 /* on input, return after each */ /* character, no erase, linekill, or */ /* eof characters, no output pause or */ /* output width truncation, treat x-off,*/ /* x-on as regular input, no tandem mode*/ /* (ie, no input buff ctl), no abort */ /* signal (^C), no use./equ/modeequ.h 7421 77777 77777 23367 4026367115 7211 0*/ #define S_NOCHG 126 /* no change of baudrate */ #define S_UNINIT 127 /* uninitialized baudrate */ #define Sfl_AUTO 0x80 /* (bit 7): input CRs from keyboard to */ /* set baud */ /* contents of the D3-register & D4-register for MD_MODE1 calls */ #define TANDEM 0x01 #define XTAB 0x02 /* expand TABs */ #define LCASE 0x04 /* convert alphabetics to lower case  /* page length (lines) */ #define MD_WIDTH 11 /* page width (columns) */ #define MD_BMARGIN 12 /* bottom margin (lines) */ #define MODELEN (MD_BMARGIN + 1) #define MD_FORMS 254 /* printer forms number */ #define MD_IDENT 255 /* device identification */ /* the following are for SLPT only */ #define SLPT_BSIZE MD_ERASE /* ETX */ #define NOTIMMECHO 0x02 /* do not echo characters */ /* typed-ahead */ #define NOECNL 0x04 /* do not echo NLs */ #define SGENABLE 0x08 /* user-specifiable key signal enable */ #define ABENABLE 0x10 /* CNTRL-C key signal enable */ #define XFF 0x20 /* expand FFs */ #define WRAP 0x40 /* wrap-around if page width is exceeded */ #defdataphone */ /* 1 50 baud */ /* 2 75 baud */ #define S_110 3 /* 110 baud */ /* 4 134.5 baud */ #define S_150 5 /* 150 baud */ /* 6 200 baud */ #define S_300 7 /* 300 baud */ /* 8 600 baud */ #define S_1200 r signal, no */ /* changing or checking parity bit, no */ /* delays after control chars as nls, */ /* no echoing, no character */ /* transformations, no function key */ /* decoding. */ #define CRIGNORE 0x40 /* On output, ignore CR and change LF */ /* to CR */ #define DISCARD 0x80 /* discard the device when it is no */ /* longer open */ /* bits of /* Modeequ.h: Cromemco 68000 C I/O header file Copyright (c) 1985 by Cromemco, Inc., All Rights Reserved This file contains declarations of all values which are used in the getmode and setmode Cromix system calls. Jun 05-86 */ #define MD_ISPEED 0 /* input speed */ #define MD_OSPEED 1 /* output speed */ #define MD_MODE1 2 /* flags: RAW, ECHO, etc. */ #define MD_MODED 3 /* */ #define ECHO 0x08 /* echo input */ #define CRDEVICE 0x10 /* on input, map CR into NL */ /* on output, echo LF or CR as CRLF */ #define RAW 0x20 /* on input, return after each */ /* character */ /* and treat ^C, ^S, ^Q as regular */ /* input */ #define ODD 0x40 /* parity function bits */ #define EVEN /ACK block size */ /* the following are for TYP only */ #define TYP_CWIDTH 64 /* character width in 1/120 in */ #define TYP_LHEIGHT 65 /* line height in 1/48 in */ #define TYP_LMARGIN 66 /* left margin in columns (1/10)*/ /* the following are commands, not displacements in the device structure */ #define MD_STATUS 156 /* flag: character is in one */ /* of the input qine SIGALLC 0x80 /* send siguser signal for each key pushed */ /* contents of the D3-register & D4-register for MD_MODE3 calls */ #define ESCRETN 0x01 /* ESC causes input line to be */ /* returned */ #define FNKEYS 0x02 /* enable response to 3102 function keys */ #define HUPENAB 0x04 /* hang up modem when device finally closed */ #define SIGHUPALL 0x08 /* send sighangup signals to all processes */ /@ the D3-register for MD_STATUS calls */ #define INOTEMPTY 0x01 /* there is a character in the input */ /* buffer (but if not RAW mode, it won't*/ /* be accessible until a whole line is */ /* entered) */ /* contents of the D3-register for MD_MODEM _getmode call */ #define RXDA 0x01 /* Receiver Data Available */ #define TXBE 0x04 /* Transmitter Buffer Empty */ #define DCD 0x08 AW, ECHO, etc. MD_MODED defv 3 ; delays for NL, CR, etc. MD_MODE2 defv 4 ; flags: PAUSE, XFF, etc. MD_MODE3 defv 5 ; flags: CBREAK, VRAW, etc. MD_ERASE defv 6 ; auxilliary erase character MD_DELECHO defv 7 ; erasure echo character MD_LKILL defv 8 ; line kill character MD_USIGNAL defv 9 ; SIGUSER signal key MD_LENGTH defv 10 */ #define TYPOFL 0x10 /* The 3355 printer is off-line */ /* contents of D3-register for MD_IDENT call */ #define ID_TTY 0 /* Tuart terminal */ #define ID_QTTY 1 /* Quadart or Octart terminal */ #define ID_LPT 2 /* Parallel printer */ #define ID_TYP 3 /* Fully formed printer */ #define ID_SLPT 4 /* Serial printer to disable them MD_PSIGHUP defv 151 ; signal current process if hang up ; defv 150 ; (this value reserved) MD_MODEM defv 148 ; (QTTYs and MTTYs only) MD_TYP defv 147 ; (TYP only) ; d-register values for MD_ISPEED baudrate calls S_HANGUP defv 0 ; hang up phone ; defv 1 ; 50 baud ; defv 2 ; 75 baud S_110 defv 3 ./equ/modeequ.z80 7421 77777 77777 20210 4026367134 7364 0 defv 0 ; send XOFF/XON to control filling of input buf XTAB defv 1 ; expand TABs LCASE defv 2 ; convert alphabetics to lower case ECHO defv 3 ; echo input CRDEVICE defv 4 ; on input, map CR into NL, ; on output, change NL to CRLF. RAW defv 5 ; on input, return after each character, ; no erase, linekill, or EOF characters, ; no output PAUSE or output width truncation, ; treat X-OFF & X- /* Data Carrier Detect */ #define CTS 0x20 /* Clear To Send */ #define RXBREAK 0x80 /* Receiver data line broken */ /* contents of the D4-register for MD_MODEM _getmode call */ #define notRI 0x40 /* Not Ringing */ #define notDSR 0x80 /* Data Set not Ready */ /* contents of the D3-register & D4-register for MD_MODEM _setmode call */ #define RTS ; page length (lines) MD_WIDTH defv 11 ; page width (columns) MD_BMARGIN defv 12 ; bottom margin (lines) MODELEN defv MD_BMARGIN + 1 MD_FORMS defv 254 ; printer forms number MD_IDENT defv 255 ; device identification ; more c-register values for SLPT only SLPT_BSIZE defv MD_ERASE ; ETX/ACK block size ; more c-register values for TYP only TYP_CWIDTH defv 64 ; character wid */ #define ID_QSLPT 5 /* Serial printer on quadart */ #define ID_CNET 6 /* CNET driver */ #define ID_FFP 7 /* FFP processor driver */ #define ID_SYSTEM 8 /* System device */ #define ID_TIMER 9 /* Timer device */ #define ID_TAPE 10 /* Half inch tape drive */ #define ID_SCC 11 /* SCC termi ; 110 baud ; defv 4 ; 134.5 baud S_150 defv 5 ; 150 baud ; defv 6 ; 200 baud S_300 defv 7 ; 300 baud ; defv 8 ; 600 baud S_1200 defv 9 ; 1200 baud ; defv 10 ; 1800 baud S_2400 defv 11 ; 2400 baud S_4800 defv 12 ; 4800 baud S_9600 defv 13  list off list noxref ; (use this line only with ASMB version 3.08 or later) ; ; Cromemco Inc. ; Sep 09, 1985 ; ; ----------------------------------------------------------------------------- ; mode definitions for terminals and printers, ; TTY, QTTY, MTTY, LPT, SLPT, QSLPT, and TYP ; c-register values for .GETMODE and .SETMODE system calls MD_ISPEED defv 0 ; input speed MD_OSPEED defv 1 ; output speed MD_MODE1 defv 2 ; flags: RON as regular input. ODD defv 6 ; parity function bits EVEN defv 7 ; ; d-register & e-register values for MD_MODED calls NLDELAY defv 03H ; (pairs of bits) TABDELAY defv 0CH ; CRDELAY defv 30H ; FFDELAY defv 40H ; (single bits) BSDELAY defv 80H ; ; d-register & e-register bits for MD_MODE2 calls PAUSE defv 0 ; wait for CNTRL-Q after a page is output NOTIMMECHO defv  0x02 /* Request To Send */ #define TXBREAK 0x10 /* Break the Transmitter line */ #define DTR 0x80 /* Data Terminal Ready */ /* contents of the D3-register for MD_TYP call */ #define TYPCHK 0x02 /* The 3355 printer is in check cond. */ #define TYPPAP 0x04 /* The 3355 printer is out of paper */ #define TYPRIB 0x08 /* The 3355 printer is out of ribbon th in 1/120 inches TYP_LHEIGHT defv 65 ; line height in 1/48 inches TYP_LMARGIN defv 66 ; left margin in columns (1/10 inches) ; more c-register values for .GETMODE and .SETMODE system calls MD_STATUS defv 156 ; check whether input queues empty MD_IFLUSH defv 155 ; flush input queues MD_FNKEYS defv 152 ; turn function keys on or off ; d-register = 1 to enable fnkeys ; d-register = 0 nal */ #define ID_MAX 12 /* Maximizer */ /* Values 13 .. 127 reserved */ /* Values 128 .. 255 reserved for user */ /* defined drivers and devices */  ; 9600 baud ; defv 14 ; External A ; defv 15 ; External B S_19200 defv 16 ; 19200 baud S_CTSWAIT defv 125 ; wait for Clear To Send S_NOCHG defv 126 ; no change of baudrate S_UNINIT defv 127 ; baudrate has not been initialized yet Sfl_AUTO defv 7 ; (bit 7) input CRs from keyboard to set baudr ; d-register & e-register bits for MD_MODE1 calls TANDEM @ 1 ; do not echo characters typed-ahead NOECNL defv 2 ; do not echo NLs SGENABLE defv 3 ; send SIGUSER signal if MD_USIGNAL key pushed ABENABLE defv 4 ; send SIGABORT signal if CNTRL-C key pushed XFF defv 5 ; expand FFs WRAP defv 6 ; wrap-around if page width is exceeded SIGALLC defv 7 ; send SIGUSER signal for every key pushed ; d-register & e-register bits for MD_MODE3 calls ESCRETN de./equ/msg.h 7421 77777 77777 4310 4026367153 6305 0ut, ignore CR, change LF to CR DISCARD defv 7 ; discard the device when it is no longer open ; d-register bits for MD_STATUS calls INOTEMPTY defv 0 ; there is a character in the input buffer ; (but if not CBREAK, RAW, or BINARY mode, ; it won't be accessible until a whole line ; is entered) ; .GETMODE d-register bits for MD_MODEM calls RXDA defv 0 ; Receiver Data Available TXBE defv 2 ; Transmitter Buffer Empty DCD truct msg *msg_last; /* Pointer to last message */ unsigned long msg_stime; /* Last send time */ unsigned long msg_rtime; /* Last receive time */ unsigned long msg_ctime; /* Last change time */ unsigned short msg_cbytes; /* Current # of bytes on queue */ unsigned short msg_qnum; /* Current # of msg on queue */ unsigned short msg_qbytes; /* Max # of bytes on queue */